BLASTX nr result
ID: Ophiopogon21_contig00042687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042687 (409 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013319843.1| hypothetical protein PV05_03717 [Exophiala x... 57 7e-06 >ref|XP_013319843.1| hypothetical protein PV05_03717 [Exophiala xenobiotica] gi|759282755|gb|KIW59258.1| hypothetical protein PV05_03717 [Exophiala xenobiotica] Length = 786 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 332 RTGSGLGSRTTSPVSFGYPYHQTSQNAMFSESPTMTAIHG 213 R+GS GSR+ SPV FGYPYH +SQ+++ SE+PT TAI G Sbjct: 747 RSGSYFGSRSQSPVLFGYPYHSSSQHSLMSETPTPTAIRG 786