BLASTX nr result
ID: Ophiopogon21_contig00042447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042447 (435 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO18527.1| hypothetical protein M407DRAFT_83836, partial [Tu... 94 5e-17 >gb|KIO18527.1| hypothetical protein M407DRAFT_83836, partial [Tulasnella calospora MUT 4182] Length = 161 Score = 93.6 bits (231), Expect = 5e-17 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (1%) Frame = -1 Query: 435 AVVGRSNSGYIATGMESISRANKLEDSDRYSLRPARQHH-PRSGHAYAPYGNGSQQS 268 A VGRSNSGYIATGMES++RA+KLED+D Y LRPARQHH PRS H YAPYGNGSQQS Sbjct: 106 AAVGRSNSGYIATGMESMARASKLEDTDHYPLRPARQHHHPRSAH-YAPYGNGSQQS 161