BLASTX nr result
ID: Ophiopogon21_contig00042424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042424 (399 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010932712.1| PREDICTED: DELLA protein RGL1-like [Elaeis g... 65 2e-08 >ref|XP_010932712.1| PREDICTED: DELLA protein RGL1-like [Elaeis guineensis] Length = 503 Score = 65.1 bits (157), Expect = 2e-08 Identities = 43/116 (37%), Positives = 59/116 (50%), Gaps = 19/116 (16%) Frame = -2 Query: 368 MSPGQFRQ-HNQFLQSIYDNDEPGNENGLELTKPKLPKLAPFMPCHSYLLPTWDLSTHAP 192 MS G + Q Q LQ + N+E +ENGL+LT + K+AP+ + LLPTWD S Sbjct: 1 MSHGPYLQLQQQQLQQLAYNEEGEDENGLKLTLSHMAKMAPYPS--TCLLPTWDHSFPLS 58 Query: 191 TFSPPLGSPRQCKRPRTDS------------------WLHFRDHISSYKQRLTALQ 78 PPL R+CK+PR +S L FRDH+ +YKQ+ L+ Sbjct: 59 LPPPPLELTRRCKKPRINSDTMTPNQVNNGKQSNPLRKLQFRDHVQNYKQKFGVLE 114