BLASTX nr result
ID: Ophiopogon21_contig00042384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042384 (482 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008076256.1| SH3-domain-containing protein [Glarea lozoye... 82 2e-13 gb|KHJ34943.1| putative sh3-domain-containing protein [Erysiphe ... 59 1e-06 >ref|XP_008076256.1| SH3-domain-containing protein [Glarea lozoyensis ATCC 20868] gi|512208124|gb|EPE36941.1| SH3-domain-containing protein [Glarea lozoyensis ATCC 20868] Length = 329 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 116 MPSYGSLHSPSLRKMNGGMDMKGRRTGGMRTMSMDNIL 3 MPSYGSLHSPSLRKMNGGMDMKGRRTGGMRTMSMDNIL Sbjct: 1 MPSYGSLHSPSLRKMNGGMDMKGRRTGGMRTMSMDNIL 38 >gb|KHJ34943.1| putative sh3-domain-containing protein [Erysiphe necator] Length = 329 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 116 MPSYGSLHSPSLRKMNGGMDMKGRRTGGMRTMSMDNIL 3 MPSYGSLHSPSLRKMNGG+D RR MR + +DNIL Sbjct: 1 MPSYGSLHSPSLRKMNGGIDGNSRRLDNMRPVDLDNIL 38