BLASTX nr result
ID: Ophiopogon21_contig00042362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042362 (550 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW25757.1| hypothetical protein PV07_08912 [Cladophialophora... 64 6e-08 >gb|KIW25757.1| hypothetical protein PV07_08912 [Cladophialophora immunda] Length = 65 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 292 GFGSKIQNSFKSTTQYVVRRAKEHHASVNEAYQTFYGLNAPSSRR 158 G +K+ +S+KS TQY+ ++AKEHH VNEAY+ +YGLN P+SRR Sbjct: 20 GLRNKVHSSWKSATQYISQKAKEHHRGVNEAYRAYYGLNVPTSRR 64