BLASTX nr result
ID: Ophiopogon21_contig00042318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042318 (620 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX57480.1| hypothetical protein RirG_206720 [Rhizophagus irr... 141 3e-31 >gb|EXX57480.1| hypothetical protein RirG_206720 [Rhizophagus irregularis DAOM 197198w] Length = 83 Score = 141 bits (356), Expect = 3e-31 Identities = 71/83 (85%), Positives = 77/83 (92%), Gaps = 3/83 (3%) Frame = -3 Query: 369 MKSLISSIRT---QISINHHIVDISTSANTSCLVELGPWERTLVHSLIALSLALVFYAAF 199 MKSLISSIRT QISINHHIVDISTSA+TSCLVELGPWERTL+HSLIALSLALV YAA+ Sbjct: 1 MKSLISSIRTIRTQISINHHIVDISTSASTSCLVELGPWERTLIHSLIALSLALVVYAAW 60 Query: 198 DPRIEGDLFATQLIEYNYNPVHY 130 DPR+EGDL A +LIE+NYNPVHY Sbjct: 61 DPRVEGDLLAVKLIEHNYNPVHY 83