BLASTX nr result
ID: Ophiopogon21_contig00042276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042276 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIM62037.1| hypothetical protein SCLCIDRAFT_1215375 [Sclerode... 57 7e-06 ref|XP_003028332.1| hypothetical protein SCHCODRAFT_70313 [Schiz... 57 7e-06 gb|KIY70413.1| hypothetical protein CYLTODRAFT_488088 [Cylindrob... 56 9e-06 gb|KIK37933.1| hypothetical protein CY34DRAFT_809866 [Suillus lu... 56 9e-06 >gb|KIM62037.1| hypothetical protein SCLCIDRAFT_1215375 [Scleroderma citrinum Foug A] Length = 284 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -3 Query: 379 YGFGRQGEKAAALKGFILTKPVETLPKYASQ 287 YGFGRQGEKAA +KGF+++KPVETLP+YA++ Sbjct: 230 YGFGRQGEKAAGMKGFLISKPVETLPRYAAR 260 >ref|XP_003028332.1| hypothetical protein SCHCODRAFT_70313 [Schizophyllum commune H4-8] gi|300102020|gb|EFI93429.1| hypothetical protein SCHCODRAFT_70313 [Schizophyllum commune H4-8] Length = 257 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = -3 Query: 379 YGFGRQGEKAAALKGFILTKPVETLPKYASQL 284 +GFGRQGEKAA LKG+++TKP+ETLP+YA++L Sbjct: 221 FGFGRQGEKAAGLKGYLITKPMETLPRYAAKL 252 >gb|KIY70413.1| hypothetical protein CYLTODRAFT_488088 [Cylindrobasidium torrendii FP15055 ss-10] Length = 311 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 379 YGFGRQGEKAAALKGFILTKPVETLPKYAS 290 +GFGRQGEKAA LKGF+LT+PVE+LP+YAS Sbjct: 232 FGFGRQGEKAAGLKGFLLTRPVESLPRYAS 261 >gb|KIK37933.1| hypothetical protein CY34DRAFT_809866 [Suillus luteus UH-Slu-Lm8-n1] Length = 291 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -3 Query: 379 YGFGRQGEKAAALKGFILTKPVETLPKYASQ 287 YGFGRQGEKAA LKGF+++KP+ETLP+YA++ Sbjct: 236 YGFGRQGEKAAGLKGFLISKPLETLPRYAAR 266