BLASTX nr result
ID: Ophiopogon21_contig00042214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042214 (361 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_049503661.1| hypothetical protein [Streptococcus parasang... 79 2e-12 gb|KJU89280.1| hypothetical protein TZ97_00992 [Streptococcus pa... 79 2e-12 gb|EFX38946.1| hypothetical protein HMPREF8577_0804 [Streptococc... 79 2e-12 gb|EHI75657.1| hypothetical protein HMPREF9184_01862, partial [S... 77 7e-12 ref|WP_053267426.1| hypothetical protein [Lactobacillus plantaru... 76 9e-12 ref|WP_041142658.1| extracellular protein, lysine-rich [Lactobac... 76 9e-12 ref|WP_016526892.1| hypothetical protein [Lactobacillus plantaru... 76 9e-12 ref|WP_016511936.1| hypothetical protein [Lactobacillus plantaru... 76 9e-12 ref|WP_003646447.1| hypothetical protein [Lactobacillus plantaru... 76 9e-12 ref|WP_007592494.1| hypothetical protein [Lachnoanaerobaculum sp... 76 9e-12 ref|WP_008753105.1| hypothetical protein [Lachnoanaerobaculum sa... 76 9e-12 gb|EHS82981.1| extracellular protein, lysine-rich [Lactobacillus... 76 9e-12 gb|EFU75934.1| hypothetical protein HMPREF0381_2188, partial [La... 76 9e-12 ref|WP_034214938.1| hypothetical protein [Lachnoanaerobaculum sp... 75 1e-11 ref|WP_031668173.1| transposase [Listeria monocytogenes] gi|5903... 75 3e-11 ref|WP_023552542.1| transposase [Listeria monocytogenes] gi|5238... 75 3e-11 ref|WP_054519364.1| hypothetical protein, partial [Lactobacillus... 74 3e-11 ref|WP_009221251.1| hypothetical protein [Lachnospiraceae bacter... 74 3e-11 ref|WP_052425482.1| hypothetical protein [Mycobacterium kyorinense] 74 4e-11 ref|WP_051691504.1| hypothetical protein [Mangrovibacter sp. MFB... 73 7e-11 >ref|WP_049503661.1| hypothetical protein [Streptococcus parasanguinis] Length = 602 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/88 (42%), Positives = 57/88 (64%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D TP+S W++AS ++A+Q SG+ V+G++ Sbjct: 503 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNTPSSVTAWEEASNVYAEQVSGEIRAVVGSE 562 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK N +T+V I+ Sbjct: 563 LRPGNIWENIELPRLKANPNVTKVTTID 590 >gb|KJU89280.1| hypothetical protein TZ97_00992 [Streptococcus parasanguinis] Length = 432 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/88 (42%), Positives = 57/88 (64%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D TP+S W++AS ++A+Q SG+ V+G++ Sbjct: 333 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNTPSSVTAWEEASNVYAEQVSGEIRAVVGSE 392 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK N +T+V I+ Sbjct: 393 LRPGNIWENIELPRLKANPNVTKVTTID 420 >gb|EFX38946.1| hypothetical protein HMPREF8577_0804 [Streptococcus parasanguinis ATCC 903] Length = 602 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/88 (42%), Positives = 57/88 (64%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D TP+S W++AS ++A+Q SG+ V+G++ Sbjct: 503 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNTPSSVTAWEEASNVYAEQVSGEIRAVVGSE 562 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK N +T+V I+ Sbjct: 563 LRPGNIWENIELPRLKANPNVTKVTTID 590 >gb|EHI75657.1| hypothetical protein HMPREF9184_01862, partial [Streptococcus sp. oral taxon 058 str. F0407] Length = 188 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/88 (40%), Positives = 56/88 (63%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D P+S W++AS ++A+Q SG+ V+G++ Sbjct: 89 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNAPSSVTAWEEASNVYAEQVSGEIRAVVGSE 148 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK N +T+V I+ Sbjct: 149 LRPGNIWENIELPRLKANPNVTKVTTID 176 >ref|WP_053267426.1| hypothetical protein [Lactobacillus plantarum] gi|917674820|gb|KOE72408.1| extracellular protein, lysine-rich [Lactobacillus plantarum] Length = 598 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/88 (42%), Positives = 55/88 (62%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MPE+D P S K W AS +A+Q SG+ V+G++ Sbjct: 498 AADVAKSKGGVTLESTIGNKNIKMPEWDFNKPESMKAWDLASGSYAEQVSGEVRAVVGSE 557 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E +E P LK N +T++ I+ Sbjct: 558 LRKGNIWENVELPRLKNNPKVTKITTID 585 >ref|WP_041142658.1| extracellular protein, lysine-rich [Lactobacillus plantarum] gi|749389618|gb|AGL63076.2| hypothetical protein LBP_cg0330 [Lactobacillus plantarum subsp. plantarum P-8] Length = 610 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/88 (42%), Positives = 55/88 (62%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MPE+D P S K W AS +A+Q SG+ V+G++ Sbjct: 510 AADVAKSKGGVTLESTIGNKNIKMPEWDFNKPESMKAWDLASGSYAEQVSGEVRAVVGSE 569 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E +E P LK N +T++ I+ Sbjct: 570 LRKGNIWENVELPRLKNNPKVTKITTID 597 >ref|WP_016526892.1| hypothetical protein [Lactobacillus plantarum] gi|513034639|gb|AGO07035.1| extracellular protein, lysine-rich [Lactobacillus plantarum 16] Length = 610 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/88 (42%), Positives = 55/88 (62%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MPE+D P S K W AS +A+Q SG+ V+G++ Sbjct: 510 AADVAKSKGGVTLESTIGNKNIKMPEWDFNKPESMKAWDLASGSYAEQVSGEVRAVVGSE 569 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E +E P LK N +T++ I+ Sbjct: 570 LRKGNIWENVELPRLKNNPKVTKITTID 597 >ref|WP_016511936.1| hypothetical protein [Lactobacillus plantarum] gi|511779324|gb|EPD22922.1| hypothetical protein L103_15694 [Lactobacillus plantarum IPLA88] Length = 582 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/88 (42%), Positives = 55/88 (62%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MPE+D P S K W AS +A+Q SG+ V+G++ Sbjct: 482 AADVAKSKGGVTLESTIGNKNIKMPEWDFNKPESMKAWDLASGSYAEQVSGEVRAVVGSE 541 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E +E P LK N +T++ I+ Sbjct: 542 LRKGNIWENVELPRLKNNPKVTKITTID 569 >ref|WP_003646447.1| hypothetical protein [Lactobacillus plantarum] gi|468443149|gb|EMP42897.1| hypothetical protein H073_13801 [Lactobacillus plantarum UCMA 3037] Length = 610 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/88 (42%), Positives = 55/88 (62%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MPE+D P S K W AS +A+Q SG+ V+G++ Sbjct: 510 AADVAKSKGGVTLESTIGNKNIKMPEWDFNKPESMKAWDLASGSYAEQVSGEVRAVVGSE 569 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E +E P LK N +T++ I+ Sbjct: 570 LRKGNIWENVELPRLKNNPKVTKITTID 597 >ref|WP_007592494.1| hypothetical protein [Lachnoanaerobaculum sp. OBRC5-5] gi|404344277|gb|EJZ70635.1| hypothetical protein HMPREF1135_00898 [Lachnoanaerobaculum sp. OBRC5-5] Length = 103 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/88 (39%), Positives = 56/88 (63%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D P+S W++AS ++A+Q SG+ V+G++ Sbjct: 4 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNAPSSVTAWEEASNVYAEQVSGEIRAVVGSE 63 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK N +T++ I+ Sbjct: 64 LRPGNIWENIELPRLKANPNVTKITTID 91 >ref|WP_008753105.1| hypothetical protein [Lachnoanaerobaculum saburreum] gi|383305466|gb|EIC96830.1| hypothetical protein HMPREF9970_0184 [Lachnoanaerobaculum saburreum F0468] Length = 402 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/88 (39%), Positives = 56/88 (63%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D P+S W++AS ++A+Q SG+ V+G++ Sbjct: 303 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNAPSSVTAWEEASNVYAEQVSGEIRAVVGSE 362 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK N +T++ I+ Sbjct: 363 LRPGNIWENIELPRLKANPNVTKITTID 390 >gb|EHS82981.1| extracellular protein, lysine-rich [Lactobacillus plantarum subsp. plantarum NC8] Length = 256 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/88 (42%), Positives = 55/88 (62%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MPE+D P S K W AS +A+Q SG+ V+G++ Sbjct: 156 AADVAKSKGGVTLESTIGNKNIKMPEWDFNKPESMKAWDLASGSYAEQVSGEVRAVVGSE 215 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E +E P LK N +T++ I+ Sbjct: 216 LRKGNIWENVELPRLKNNPKVTKITTID 243 >gb|EFU75934.1| hypothetical protein HMPREF0381_2188, partial [Lachnoanaerobaculum saburreum DSM 3986] Length = 213 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/88 (39%), Positives = 56/88 (63%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D P+S W++AS ++A+Q SG+ V+G++ Sbjct: 114 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNAPSSVTAWEEASNVYAEQVSGEIRAVVGSE 173 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK N +T++ I+ Sbjct: 174 LRPGNIWENIELPRLKANPNVTKITTID 201 >ref|WP_034214938.1| hypothetical protein [Lachnoanaerobaculum sp. MSX33] gi|570841218|gb|ETO95034.1| hypothetical protein HMPREF1495_0104 [Lachnoanaerobaculum sp. MSX33] Length = 103 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/88 (39%), Positives = 56/88 (63%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D P+S W++AS ++A+Q SG+ V+G++ Sbjct: 4 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNAPSSVTAWEEASNVYAEQVSGEIRAVVGSE 63 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK N +T++ I+ Sbjct: 64 LRLGNIWENIELPRLKANPNVTKITTID 91 >ref|WP_031668173.1| transposase [Listeria monocytogenes] gi|590396611|gb|EXL16655.1| hypothetical protein X843_1186 [Listeria monocytogenes Lm_1840] Length = 468 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/88 (40%), Positives = 54/88 (61%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MP++D P S K W AS +A+Q SG+ V+G+ Sbjct: 368 AADVAKSKGGVTLESTIGNKNIEMPDWDFNNPESMKAWDLASGSYAEQVSGEVRAVVGSD 427 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E +E P LK N +T++ I+ Sbjct: 428 LRKGNIWENVELPRLKNNPNVTKITTID 455 >ref|WP_023552542.1| transposase [Listeria monocytogenes] gi|523839443|gb|AGR03309.1| transposase [Listeria monocytogenes] gi|664821900|gb|KES28623.1| transposase [Listeria monocytogenes] gi|664828712|gb|KES35375.1| transposase [Listeria monocytogenes] gi|665047462|gb|KEU52074.1| transposase [Listeria monocytogenes] gi|665312810|gb|KEX14624.1| transposase [Listeria monocytogenes] gi|665337010|gb|KEX38573.1| transposase [Listeria monocytogenes] gi|665345107|gb|KEX46555.1| transposase [Listeria monocytogenes] gi|665349745|gb|KEX51118.1| transposase [Listeria monocytogenes] gi|733118311|gb|KHK11015.1| hypothetical protein I793_08755 [Listeria monocytogenes SHL001] gi|913042040|gb|KNX97070.1| transposase [Listeria monocytogenes] Length = 468 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/88 (40%), Positives = 54/88 (61%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MP++D P S K W AS +A+Q SG+ V+G+ Sbjct: 368 AADVAKSKGGVTLESTIGNKNIEMPDWDFNNPESMKAWDLASGSYAEQVSGEVRAVVGSD 427 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E +E P LK N +T++ I+ Sbjct: 428 LRKGNIWENVELPRLKNNPNVTKITTID 455 >ref|WP_054519364.1| hypothetical protein, partial [Lactobacillus plantarum] gi|932707296|gb|ERJ62607.2| hypothetical protein N876_0215170, partial [Lactobacillus plantarum 2025] Length = 408 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/88 (40%), Positives = 55/88 (62%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A DVAK+KGG TLE ++ + MPE+D P S K W AS +A+Q SG+ V+G++ Sbjct: 308 AADVAKSKGGVTLESTIGNKNIKMPEWDFNKPESMKAWDLASGSYAEQVSGEVRAVVGSE 367 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L +++E +E P LK N +T++ I+ Sbjct: 368 LRKGDIWENVELPRLKNNPKVTKITTID 395 >ref|WP_009221251.1| hypothetical protein [Lachnospiraceae bacterium oral taxon 500] gi|330409225|gb|EGG88675.1| hypothetical protein HMPREF0491_03024 [Lachnospiraceae oral taxon 107 str. F0167] Length = 399 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/88 (38%), Positives = 56/88 (63%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +AK KGG TLE ++ + MPE+D P+S W++AS ++A+Q SG+ V+G++ Sbjct: 300 AKKIAKNKGGVTLESTIDDTNIVMPEWDFNAPSSVTAWEEASNVYAEQVSGEIRAVVGSE 359 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N++E IE P LK + +T++ I+ Sbjct: 360 LRPGNIWENIELPRLKASPNVTKITTID 387 >ref|WP_052425482.1| hypothetical protein [Mycobacterium kyorinense] Length = 483 Score = 73.9 bits (180), Expect = 4e-11 Identities = 38/88 (43%), Positives = 51/88 (57%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A D+A GG TLE LA AG+ PE+D P S WK ASEI+A SG+ V+G+ Sbjct: 384 AADIAGQHGGVTLESLLARAGVKAPEWDANNPTSVSWWKKASEIYASGVSGEVRAVIGSD 443 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKIN 69 L N+++ IE AL N +T + +IN Sbjct: 444 LRPGNIWQNIELKALMGNPAVTRIVEIN 471 >ref|WP_051691504.1| hypothetical protein [Mangrovibacter sp. MFB070] Length = 353 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/92 (36%), Positives = 56/92 (60%) Frame = -3 Query: 332 ALDVAKAKGGKTLEGSLAAAGLTMPEFDTRTPASTKIWKDASEIFAQQASGKAFVVMGTK 153 A +A+++GG TLE ++ G+ MPE+D P S K W+D S +A+Q SG+ V+G Sbjct: 252 AESIARSRGGVTLESTIKDKGIEMPEWDFDNPQSIKAWEDVSASYAKQVSGEIRAVVGES 311 Query: 152 LNGCNVFETIEFPALKKNKIITEVRKINGLDR 57 L N++E +E P L N +T++ I+ L++ Sbjct: 312 LREGNIWENVELPRLMSNDSVTKITTIDPLNQ 343