BLASTX nr result
ID: Ophiopogon21_contig00042083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042083 (571 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013277335.1| hypothetical protein Z518_01280 [Rhinocladie... 58 4e-06 >ref|XP_013277335.1| hypothetical protein Z518_01280 [Rhinocladiella mackenziei CBS 650.93] gi|759333875|gb|KIX10199.1| hypothetical protein Z518_01280 [Rhinocladiella mackenziei CBS 650.93] Length = 86 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 439 FLLPTNEQQTPVAIYDAPLRRPLFHHAKAGNEETLSARR 323 FLLPT+E PV IYD PLRR LFH AK+GNE T+SA R Sbjct: 13 FLLPTDEPAAPVRIYDVPLRRELFHKAKSGNEYTISASR 51