BLASTX nr result
ID: Ophiopogon21_contig00042066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042066 (938 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW95769.1| hypothetical protein Z519_02833 [Cladophialophora... 74 1e-10 ref|XP_013282090.1| hypothetical protein Z517_08117 [Fonsecaea p... 74 1e-10 gb|KIW24206.1| hypothetical protein PV07_09934 [Cladophialophora... 74 1e-10 ref|XP_007751258.1| hypothetical protein A1O5_12499 [Cladophialo... 74 1e-10 gb|KIX95857.1| hypothetical protein Z520_08565 [Fonsecaea multim... 73 4e-10 ref|XP_013273390.1| hypothetical protein Z518_04229 [Rhinocladie... 69 5e-09 gb|KIW44915.1| hypothetical protein PV06_03351 [Exophiala oligos... 69 5e-09 gb|KIW73259.1| hypothetical protein PV04_01391 [Capronia semiimm... 69 7e-09 ref|XP_007752879.1| hypothetical protein A1O7_00648 [Cladophialo... 69 7e-09 ref|XP_008722317.1| hypothetical protein G647_00692 [Cladophialo... 69 7e-09 gb|KIV79218.1| hypothetical protein PV11_06788 [Exophiala sideris] 68 9e-09 gb|KIW15380.1| hypothetical protein PV08_05426 [Exophiala spinif... 67 2e-08 ref|XP_007729295.1| hypothetical protein A1O3_00956 [Capronia ep... 67 2e-08 ref|XP_007725066.1| hypothetical protein A1O1_05994 [Capronia co... 67 2e-08 ref|XP_009155196.1| hypothetical protein HMPREF1120_02900 [Exoph... 67 2e-08 gb|KIV89248.1| hypothetical protein PV10_08828 [Exophiala mesoph... 67 3e-08 ref|XP_013310696.1| hypothetical protein PV05_11730 [Exophiala x... 66 3e-08 gb|KPI38839.1| hypothetical protein AB675_5936 [Phialophora attae] 64 1e-07 ref|XP_008711188.1| hypothetical protein HMPREF1541_00661 [Cyphe... 64 1e-07 ref|XP_007803225.1| hypothetical protein EPUS_09119 [Endocarpon ... 62 8e-07 >gb|KIW95769.1| hypothetical protein Z519_02833 [Cladophialophora bantiana CBS 173.52] Length = 354 Score = 74.3 bits (181), Expect = 1e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLTPQPCST+AG+ +FGWDRYQEY MPYA AM Sbjct: 318 LPLPSMLTPQPCSTSAGLSTFGWDRYQEYTMPYATAM 354 >ref|XP_013282090.1| hypothetical protein Z517_08117 [Fonsecaea pedrosoi CBS 271.37] gi|759301875|gb|KIW78282.1| hypothetical protein Z517_08117 [Fonsecaea pedrosoi CBS 271.37] Length = 354 Score = 74.3 bits (181), Expect = 1e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLTPQPCST+AG+ +FGWDRYQEY MPYA AM Sbjct: 318 LPLPSMLTPQPCSTSAGLSTFGWDRYQEYTMPYATAM 354 >gb|KIW24206.1| hypothetical protein PV07_09934 [Cladophialophora immunda] Length = 354 Score = 74.3 bits (181), Expect = 1e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLTPQPCST+AG+ +FGWDRYQEY MPYA AM Sbjct: 318 LPLPSMLTPQPCSTSAGLSTFGWDRYQEYTMPYATAM 354 >ref|XP_007751258.1| hypothetical protein A1O5_12499 [Cladophialophora psammophila CBS 110553] gi|589974394|gb|EXJ57709.1| hypothetical protein A1O5_12499 [Cladophialophora psammophila CBS 110553] Length = 354 Score = 74.3 bits (181), Expect = 1e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLTPQPCST+AG+ +FGWDRYQEY MPYA AM Sbjct: 318 LPLPSMLTPQPCSTSAGLSTFGWDRYQEYTMPYATAM 354 >gb|KIX95857.1| hypothetical protein Z520_08565 [Fonsecaea multimorphosa CBS 102226] Length = 354 Score = 72.8 bits (177), Expect = 4e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLTPQPCST+AG+ +FGWDRYQEY MP+A AM Sbjct: 318 LPLPSMLTPQPCSTSAGLSTFGWDRYQEYTMPFATAM 354 >ref|XP_013273390.1| hypothetical protein Z518_04229 [Rhinocladiella mackenziei CBS 650.93] gi|759329927|gb|KIX06254.1| hypothetical protein Z518_04229 [Rhinocladiella mackenziei CBS 650.93] Length = 354 Score = 68.9 bits (167), Expect = 5e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLT QPCST+A + +FGWDRYQEY MPYA AM Sbjct: 318 LPLPSMLTQQPCSTSASLSTFGWDRYQEYTMPYATAM 354 >gb|KIW44915.1| hypothetical protein PV06_03351 [Exophiala oligosperma] Length = 354 Score = 68.9 bits (167), Expect = 5e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLT QPCST+A + +FGWDRYQEY MPYA AM Sbjct: 318 LPLPSMLTQQPCSTSASLSTFGWDRYQEYTMPYATAM 354 >gb|KIW73259.1| hypothetical protein PV04_01391 [Capronia semiimmersa] Length = 354 Score = 68.6 bits (166), Expect = 7e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSML QPCST+A + +FGWDRYQEYAMPYA AM Sbjct: 318 LPLPSMLAQQPCSTSASLSTFGWDRYQEYAMPYATAM 354 >ref|XP_007752879.1| hypothetical protein A1O7_00648 [Cladophialophora yegresii CBS 114405] gi|589981071|gb|EXJ64312.1| hypothetical protein A1O7_00648 [Cladophialophora yegresii CBS 114405] Length = 354 Score = 68.6 bits (166), Expect = 7e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSML QPCST+A + +FGWDRYQEYAMPYA AM Sbjct: 318 LPLPSMLAQQPCSTSASLSTFGWDRYQEYAMPYATAM 354 >ref|XP_008722317.1| hypothetical protein G647_00692 [Cladophialophora carrionii CBS 160.54] gi|565939137|gb|ETI28243.1| hypothetical protein G647_00692 [Cladophialophora carrionii CBS 160.54] Length = 354 Score = 68.6 bits (166), Expect = 7e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSML QPCST+A + +FGWDRYQEYAMPYA AM Sbjct: 318 LPLPSMLAQQPCSTSASLSTFGWDRYQEYAMPYATAM 354 >gb|KIV79218.1| hypothetical protein PV11_06788 [Exophiala sideris] Length = 355 Score = 68.2 bits (165), Expect = 9e-09 Identities = 31/38 (81%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -2 Query: 856 LPLPSMLTP-QPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLT QPCST+AG+ +FGWDRYQEYAMPYA AM Sbjct: 318 LPLPSMLTQHQPCSTSAGLSAFGWDRYQEYAMPYATAM 355 >gb|KIW15380.1| hypothetical protein PV08_05426 [Exophiala spinifera] Length = 354 Score = 67.4 bits (163), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLT QPCST+A + +FGWDRYQEY MP+A AM Sbjct: 318 LPLPSMLTQQPCSTSASLSTFGWDRYQEYTMPFATAM 354 >ref|XP_007729295.1| hypothetical protein A1O3_00956 [Capronia epimyces CBS 606.96] gi|590017205|gb|EXJ92405.1| hypothetical protein A1O3_00956 [Capronia epimyces CBS 606.96] Length = 355 Score = 67.0 bits (162), Expect = 2e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSML QPCST+A + +FGWDRYQEY MPYA AM Sbjct: 319 LPLPSMLAQQPCSTSASLSTFGWDRYQEYTMPYATAM 355 >ref|XP_007725066.1| hypothetical protein A1O1_05994 [Capronia coronata CBS 617.96] gi|590010423|gb|EXJ85628.1| hypothetical protein A1O1_05994 [Capronia coronata CBS 617.96] Length = 354 Score = 67.0 bits (162), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSMLT QPCST+A + ++GWDRYQEY MPYA AM Sbjct: 318 LPLPSMLTQQPCSTSATLNTYGWDRYQEYTMPYATAM 354 >ref|XP_009155196.1| hypothetical protein HMPREF1120_02900 [Exophiala dermatitidis NIH/UT8656] gi|378728276|gb|EHY54735.1| hypothetical protein HMPREF1120_02900 [Exophiala dermatitidis NIH/UT8656] Length = 359 Score = 67.0 bits (162), Expect = 2e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSML QPCST+A + +FGWDRYQEY MPYA AM Sbjct: 323 LPLPSMLAQQPCSTSASLSTFGWDRYQEYTMPYATAM 359 >gb|KIV89248.1| hypothetical protein PV10_08828 [Exophiala mesophila] Length = 354 Score = 66.6 bits (161), Expect = 3e-08 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSML QPCST A + +FGWDRYQEY MPYA AM Sbjct: 318 LPLPSMLAQQPCSTTASLSTFGWDRYQEYTMPYATAM 354 >ref|XP_013310696.1| hypothetical protein PV05_11730 [Exophiala xenobiotica] gi|759273603|gb|KIW50112.1| hypothetical protein PV05_11730 [Exophiala xenobiotica] Length = 354 Score = 66.2 bits (160), Expect = 3e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPSML QPCST+A + +FGWDRYQEY MPYA AM Sbjct: 318 LPLPSMLAQQPCSTSATLSTFGWDRYQEYTMPYATAM 354 >gb|KPI38839.1| hypothetical protein AB675_5936 [Phialophora attae] Length = 282 Score = 64.3 bits (155), Expect = 1e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPS LT QPCST+A + +FGWDRY EY MPYA AM Sbjct: 246 LPLPSTLTQQPCSTSAAISTFGWDRYNEYTMPYATAM 282 >ref|XP_008711188.1| hypothetical protein HMPREF1541_00661 [Cyphellophora europaea CBS 101466] gi|568123891|gb|ETN46476.1| hypothetical protein HMPREF1541_00661 [Cyphellophora europaea CBS 101466] Length = 352 Score = 64.3 bits (155), Expect = 1e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 856 LPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 LPLPS LT QPCST+A + +FGWDRY EY MPYA AM Sbjct: 316 LPLPSTLTQQPCSTSAAISNFGWDRYNEYTMPYATAM 352 >ref|XP_007803225.1| hypothetical protein EPUS_09119 [Endocarpon pusillum Z07020] gi|539434645|gb|ERF71133.1| hypothetical protein EPUS_09119 [Endocarpon pusillum Z07020] Length = 350 Score = 61.6 bits (148), Expect = 8e-07 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = -2 Query: 859 QLPLPSMLTPQPCSTAAGMGSFGWDRYQEYAMPYAAAM 746 QLPLPSML Q CS+ A M S+GWDRY EY MPYA AM Sbjct: 313 QLPLPSMLAQQQCSSTAAMTSYGWDRYLEYTMPYATAM 350