BLASTX nr result
ID: Ophiopogon21_contig00041176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00041176 (415 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA16920.1| hypothetical protein GLOINDRAFT_345337, partial [... 60 6e-07 >gb|ESA16920.1| hypothetical protein GLOINDRAFT_345337, partial [Rhizophagus irregularis DAOM 181602] Length = 166 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -2 Query: 162 FVPSSQLMGSPMDDPFMFEGGEYCILNQQDFCYYYYNNQLTPEEQALL 19 F+P+SQL SP+++P++FEG ++F YYYYNNQ TPEEQA+L Sbjct: 41 FIPNSQLSESPLEEPYLFEG--------EEFYYYYYNNQFTPEEQAIL 80