BLASTX nr result

ID: Ophiopogon21_contig00040735 seq

BLASTX 2.2.25 [Feb-01-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Ophiopogon21_contig00040735
         (382 letters)

Database: ./nr 
           77,306,371 sequences; 28,104,191,420 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sat...    84   1e-14
gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophi...    84   4e-14
ref|YP_654205.1| photosystem II M protein (chloroplast) [Oryza s...    80   6e-13
gb|ADD63094.1| photosystem II protein M (chloroplast) [Microlaen...    78   2e-12
ref|XP_002888353.1| hypothetical protein ARALYDRAFT_893970 [Arab...    69   1e-09
gb|KQK85735.1| hypothetical protein SETIT_020844mg, partial [Set...    67   5e-09
ref|YP_003587462.1| photosystem II protein M [Oncidium hybrid cu...    66   9e-09
gb|KJB13068.1| hypothetical protein B456_002G055100 [Gossypium r...    62   1e-08
gb|AFK38374.1| unknown [Medicago truncatula]                           65   3e-08
ref|YP_008081645.1| photosystem II protein M (chloroplast) [Cymb...    64   6e-08
gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium r...    60   6e-08
ref|YP_006503686.1| photosystem II protein M (chloroplast) [Eryc...    63   7e-08
ref|YP_009145255.1| photosystem II protein M (plastid) [Trillium...    63   1e-07
ref|YP_008994562.1| photosystem II protein M (chloroplast) (chlo...    63   1e-07
ref|YP_009040786.1| photosystem II protein M (chloroplast) (chlo...    62   1e-07
ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]...    62   2e-07
ref|YP_009122581.1| photosystem II protein M (chloroplast) [Masd...    62   2e-07
ref|YP_009109128.1| photosystem II protein M (plastid) [Corallor...    62   2e-07
gb|AKZ30297.1| photosystem II protein M (chloroplast) [Goodenia ...    62   2e-07
ref|YP_009108753.1| photosystem II protein M [Oncinotis tenuilob...    62   2e-07

>gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sativa Japonica
           Group] gi|42795608|gb|AAS46173.1| photosystem II M
           protein (chloroplast) [Oryza sativa Japonica Group]
           gi|290790563|gb|ADD62823.1| photosystem II protein M
           (chloroplast) [Oryza sativa Japonica Group]
           gi|290790632|gb|ADD62891.1| photosystem II protein M
           (chloroplast) [Oryza meridionalis]
           gi|290790701|gb|ADD62959.1| photosystem II protein M
           (chloroplast) [Oryza australiensis]
           gi|552954465|gb|AGY48933.1| photosystem II reaction
           center protein M (chloroplast) [Oryza rufipogon]
          Length = 69

 Score = 84.3 bits (207), Expect(2) = 1e-14
 Identities = 46/61 (75%), Positives = 47/61 (77%)
 Frame = +2

Query: 89  PLHLQESNFSSLWD*IPSYCETKED*IMEVNILALSATALFILVPTAFLLIIYVKTVSQN 268
           PL      F S WD IPSYCE KE  +MEVNILA  ATALFILVPTAFLLIIYVKTVSQN
Sbjct: 11  PLEFTGYPFPSPWDYIPSYCEKKE--VMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68

Query: 269 D 271
           D
Sbjct: 69  D 69



 Score = 21.9 bits (45), Expect(2) = 1e-14
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +1

Query: 58  LIQYHRDAINPVAFAGVKF 114
           +IQY+++A  P+ F G  F
Sbjct: 1   MIQYYQNASPPLEFTGYPF 19


>gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophila parviflora]
          Length = 69

 Score = 84.0 bits (206), Expect = 4e-14
 Identities = 46/61 (75%), Positives = 47/61 (77%)
 Frame = +2

Query: 89  PLHLQESNFSSLWD*IPSYCETKED*IMEVNILALSATALFILVPTAFLLIIYVKTVSQN 268
           PL      F S WD IPSYCE KE  +MEVNILA  ATALFILVPTAFLLIIYVKTVSQN
Sbjct: 11  PLEFTGYPFYSPWDYIPSYCEKKE--VMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68

Query: 269 D 271
           D
Sbjct: 69  D 69


>ref|YP_654205.1| photosystem II M protein (chloroplast) [Oryza sativa Indica Group]
           gi|42795478|gb|AAS46045.1| photosystem II M protein
           (chloroplast) [Oryza sativa Indica Group]
          Length = 68

 Score = 80.1 bits (196), Expect = 6e-13
 Identities = 39/70 (55%), Positives = 45/70 (64%)
 Frame = +1

Query: 58  LIQYHRDAINPVAFAGVKFLISMGLDPELLRNKRRLDYGSQYSRT*CYCTVHSSSYCFFT 237
           +IQY+++A  P+ F G  F       P     KR   YGSQYSR  CYC VHSSSYC FT
Sbjct: 1   MIQYYQNASPPLEFTGYPFPSPWDYIPSYCEKKR--GYGSQYSRIYCYCIVHSSSYCLFT 58

Query: 238 YHLCKNSQPK 267
           Y+LCKNSQPK
Sbjct: 59  YYLCKNSQPK 68


>gb|ADD63094.1| photosystem II protein M (chloroplast) [Microlaena stipoides]
          Length = 69

 Score = 78.2 bits (191), Expect = 2e-12
 Identities = 44/61 (72%), Positives = 45/61 (73%)
 Frame = +2

Query: 89  PLHLQESNFSSLWD*IPSYCETKED*IMEVNILALSATALFILVPTAFLLIIYVKTVSQN 268
           P     S F S WD IPSY E KE  +MEVNILA  ATALFILVPTAFLLIIYVKT SQN
Sbjct: 11  PPEFTVSPFPSPWDYIPSYYEKKE--VMEVNILAFIATALFILVPTAFLLIIYVKTASQN 68

Query: 269 D 271
           D
Sbjct: 69  D 69


>ref|XP_002888353.1| hypothetical protein ARALYDRAFT_893970 [Arabidopsis lyrata subsp.
           lyrata] gi|297334194|gb|EFH64612.1| hypothetical protein
           ARALYDRAFT_893970 [Arabidopsis lyrata subsp. lyrata]
          Length = 120

 Score = 68.9 bits (167), Expect = 1e-09
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 4/63 (6%)
 Frame = -1

Query: 301 LIIIQVSFKLIILADCFYIDDK*KSSRN*NEQCSSTKCENIDFHNLI----FFCFAITRD 134
           LI I   FKLIIL + FY++ K KSSRN NE+C S KC+NI FHNLI    +F F I+RD
Sbjct: 58  LIAIFHLFKLIILTNGFYVNYKQKSSRNENEECGSNKCKNIYFHNLIVYYYYFFFLISRD 117

Query: 133 LIP 125
           LIP
Sbjct: 118 LIP 120


>gb|KQK85735.1| hypothetical protein SETIT_020844mg, partial [Setaria italica]
          Length = 33

 Score = 67.0 bits (162), Expect = 5e-09
 Identities = 28/33 (84%), Positives = 29/33 (87%)
 Frame = +1

Query: 169 YGSQYSRT*CYCTVHSSSYCFFTYHLCKNSQPK 267
           YGSQYSR  CYC VHSSSYC FTY+LCKNSQPK
Sbjct: 1   YGSQYSRIYCYCIVHSSSYCLFTYYLCKNSQPK 33


>ref|YP_003587462.1| photosystem II protein M [Oncidium hybrid cultivar]
           gi|254833103|gb|ACT83106.1| photosystem II protein M
           [Oncidium hybrid cultivar]
          Length = 37

 Score = 66.2 bits (160), Expect = 9e-09
 Identities = 35/37 (94%), Positives = 35/37 (94%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND*FE 280
           MEVNILAL ATALFILVPTAFLLIIYVKTVSQND FE
Sbjct: 1   MEVNILALIATALFILVPTAFLLIIYVKTVSQNDEFE 37


>gb|KJB13068.1| hypothetical protein B456_002G055100 [Gossypium raimondii]
          Length = 50

 Score = 62.4 bits (150), Expect(2) = 1e-08
 Identities = 33/39 (84%), Positives = 35/39 (89%)
 Frame = +2

Query: 155 KED*IMEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           K + IMEVNILA  ATALFILVPTAFLLIIYVKTVSQ+D
Sbjct: 12  KNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 50



 Score = 23.5 bits (49), Expect(2) = 1e-08
 Identities = 9/12 (75%), Positives = 12/12 (100%)
 Frame = +1

Query: 124 MGLDPELLRNKR 159
           MGL+PELLR+K+
Sbjct: 1   MGLNPELLRSKK 12


>gb|AFK38374.1| unknown [Medicago truncatula]
          Length = 52

 Score = 64.7 bits (156), Expect = 3e-08
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 4/52 (7%)
 Frame = +1

Query: 124 MGLDPEL-LRNKRRL---DYGSQYSRT*CYCTVHSSSYCFFTYHLCKNSQPK 267
           MGL+PE+ +RNKR     DYGSQYSR   YCT+HSSSYC FTY+L KN + K
Sbjct: 1   MGLNPEVFIRNKRERKHRDYGSQYSRIYSYCTLHSSSYCLFTYNLRKNGKSK 52


>ref|YP_008081645.1| photosystem II protein M (chloroplast) [Cymbidium sinense]
           gi|511943522|ref|YP_008081801.1| photosystem II protein
           M (chloroplast) [Cymbidium tracyanum]
           gi|511943623|ref|YP_008081879.1| photosystem II protein
           M (chloroplast) [Cymbidium mannii]
           gi|512721470|ref|YP_008081723.1| photosystem II protein
           M (chloroplast) [Cymbidium tortisepalum]
           gi|520850559|ref|YP_008081567.1| photosystem II protein
           M (chloroplast) [Cymbidium aloifolium]
           gi|618750301|ref|YP_009026434.1| photosystem II protein
           M (chloroplast) [Dendrobium catenatum]
           gi|658645648|ref|YP_009045560.1| photosystem II protein
           M (chloroplast) [Cypripedium macranthos]
           gi|712911692|ref|YP_009092677.1| photosystem II protein
           M [Eustrephus latifolius]
           gi|788366076|ref|YP_009123429.1| photosystem II protein
           M (chloroplast) [Cattleya crispata]
           gi|810932674|ref|YP_009129525.1| photosystem II protein
           M (chloroplast) [Habenaria pantlingiana]
           gi|836614307|ref|YP_009144768.1| photosystem II protein
           M (chloroplast) [Elleanthus sodiroi]
           gi|910356002|ref|YP_009161824.1| photosystem II protein
           M (chloroplast) [Dendrobium strongylanthum]
           gi|918021064|ref|YP_009163395.1| photosystem II protein
           M (chloroplast) [Cymbidium faberi]
           gi|944542566|ref|YP_009176502.1| photosystem II protein
           M (chloroplast) [Sobralia aff. bouchei HTK-2015]
           gi|944543097|ref|YP_009175107.1| photosystem II protein
           M (chloroplast) [Sobralia callosa]
           gi|953244985|ref|YP_009180102.1| photosystem II protein
           M (chloroplast) [Polygonatum cyrtonema]
           gi|953245062|ref|YP_009180185.1| photosystem II protein
           M (chloroplast) [Dendrobium huoshanense]
           gi|69217320|gb|AAZ04032.1| photosystem II protein M
           [Yucca schidigera] gi|290488108|gb|ADD30438.1|
           photosystem II protein M (chloroplast) [Plumbago
           auriculata] gi|374962494|gb|AFA26835.1| photosystem II
           protein M (plastid) [Agapanthus praecox]
           gi|374962500|gb|AFA26838.1| photosystem II protein M,
           partial (plastid) [Asparagus officinalis]
           gi|374962510|gb|AFA26843.1| photosystem II protein M,
           partial (plastid) [Chlorophytum rhizopendulum]
           gi|374962512|gb|AFA26844.1| photosystem II protein M
           (plastid) [Molineria capitulata]
           gi|374962526|gb|AFA26851.1| photosystem II protein M,
           partial (plastid) [Hesperaloe parviflora]
           gi|374962528|gb|AFA26852.1| photosystem II protein M,
           partial (plastid) [Hosta ventricosa]
           gi|374962540|gb|AFA26858.1| photosystem II protein M
           (plastid) [Lomandra longifolia]
           gi|374962544|gb|AFA26860.1| photosystem II protein M,
           partial (plastid) [Neoastelia spectabilis]
           gi|374962548|gb|AFA26862.1| photosystem II protein M,
           partial (plastid) [Nolina atopocarpa]
           gi|482662080|gb|AGK25309.1| photosystem II protein M
           (chloroplast) [Cymbidium aloifolium]
           gi|482662159|gb|AGK25387.1| photosystem II protein M
           (chloroplast) [Cymbidium sinense]
           gi|482662238|gb|AGK25465.1| photosystem II protein M
           (chloroplast) [Cymbidium tortisepalum]
           gi|482662317|gb|AGK25543.1| photosystem II protein M
           (chloroplast) [Cymbidium tortisepalum]
           gi|482662396|gb|AGK25621.1| photosystem II protein M
           (chloroplast) [Cymbidium mannii]
           gi|482662475|gb|AGK25699.1| photosystem II protein M
           (chloroplast) [Cymbidium tracyanum]
           gi|482662554|gb|AGK25777.1| photosystem II protein M
           (chloroplast) [Cymbidium tortisepalum]
           gi|482662633|gb|AGK25855.1| photosystem II protein M
           (chloroplast) [Cymbidium mannii]
           gi|507474319|gb|AGM48195.1| photosystem II protein M
           (chloroplast) [Dendrobium catenatum]
           gi|578888860|gb|AHI16743.1| photosystem II protein M
           (chloroplast) (chloroplast) [Cypripedium macranthos]
           gi|655167049|gb|AIC82564.1| photosystem II protein M
           (chloroplast) [Habenaria pantlingiana]
           gi|690196741|gb|AIR12513.1| photosystem II protein M
           [Eustrephus latifolius] gi|691192179|gb|AIR76438.1|
           photosystem II M protein (chloroplast) [Dendrobium
           catenatum] gi|694174691|gb|AIS67367.1| photosystem II
           protein M (chloroplast) [Sobralia callosa]
           gi|756762310|gb|AJM70401.1| photosystem II protein M
           (chloroplast) [Cattleya crispata]
           gi|827346169|gb|AKJ77375.1| photosystem II protein M
           (chloroplast) [Elleanthus sodiroi]
           gi|827505312|gb|AKJ83589.1| photosystem II protein M
           (chloroplast) [Alocasia macrorrhizos]
           gi|906346862|gb|AKS28653.1| photosystem II protein M
           (chloroplast) [Dendrobium strongylanthum]
           gi|913021770|gb|AKU70931.1| photosystem II protein M
           (chloroplast) [Cymbidium faberi]
           gi|933501805|gb|ALG65699.1| photosystem II protein M
           (chloroplast) [Anoectochilus roxburghii]
           gi|937957600|gb|ALJ01982.1| photosystem II protein M
           (chloroplast) [Sobralia aff. bouchei HTK-2015]
           gi|944543352|gb|ALL96542.1| photosystem II protein M
           (chloroplast) [Polygonatum cyrtonema]
           gi|944543429|gb|ALL96618.1| photosystem II protein M
           (chloroplast) [Dendrobium huoshanense]
           gi|948550006|gb|ALM87785.1| photosystem II protein M
           (chloroplast) [Polygonatum verticillatum]
           gi|948550088|gb|ALM87866.1| photosystem II protein M
           (chloroplast) [Cymbidium goeringii]
           gi|948550166|gb|ALM87943.1| photosystem II protein M
           (chloroplast) [Cymbidium ensifolium]
          Length = 34

 Score = 63.5 bits (153), Expect = 6e-08
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           MEVNILAL ATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILALIATALFILVPTAFLLIIYVKTVSQND 34


>gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium raimondii]
          Length = 50

 Score = 60.1 bits (144), Expect(2) = 6e-08
 Identities = 31/39 (79%), Positives = 34/39 (87%)
 Frame = +2

Query: 155 KED*IMEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           K + IMEVNILA  ATALFILVPTAFLLIIYVKT+ Q+D
Sbjct: 12  KNNEIMEVNILAFIATALFILVPTAFLLIIYVKTICQSD 50



 Score = 23.5 bits (49), Expect(2) = 6e-08
 Identities = 9/12 (75%), Positives = 12/12 (100%)
 Frame = +1

Query: 124 MGLDPELLRNKR 159
           MGL+PELLR+K+
Sbjct: 1   MGLNPELLRSKK 12


>ref|YP_006503686.1| photosystem II protein M (chloroplast) [Erycina pusilla]
           gi|695101496|ref|YP_009057145.1| photosystem II protein
           M (chloroplast) [Allium cepa]
           gi|944543183|ref|YP_009175193.1| photosystem II protein
           M (plastid) [Oncidium sphacelatum]
           gi|339431298|gb|AEJ72492.1| photosystem II protein M
           (chloroplast) [Erycina pusilla]
           gi|567767855|gb|AHC94581.1| photosystem II protein M
           (chloroplast) [Allium cepa] gi|567767937|gb|AHC94662.1|
           photosystem II protein M (chloroplast) [Allium cepa]
           gi|694174777|gb|AIS67452.1| photosystem II protein M
           (plastid) [Oncidium sphacelatum]
           gi|744671139|gb|AJC99049.1| photosystem II protein M
           (chloroplast) [Allium cepa] gi|744671247|gb|AJC99135.1|
           photosystem II protein M (chloroplast) [Allium cepa]
           gi|744671360|gb|AJC99221.1| photosystem II protein M
           (chloroplast) [Allium cepa]
          Length = 34

 Score = 63.2 bits (152), Expect = 7e-08
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           MEVNILAL ATALFIL+PTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILALIATALFILIPTAFLLIIYVKTVSQND 34


>ref|YP_009145255.1| photosystem II protein M (plastid) [Trillium decumbens]
           gi|828348672|gb|AKK32133.1| photosystem II protein M
           (plastid) [Trillium decumbens]
          Length = 37

 Score = 62.8 bits (151), Expect = 1e-07
 Identities = 33/37 (89%), Positives = 34/37 (91%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND*FE 280
           MEVNILA  ATALFILVPTAFLLIIYVKTVSQN+ FE
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQNNEFE 37


>ref|YP_008994562.1| photosystem II protein M (chloroplast) (chloroplast) [Pelargonium
           alternans] gi|540067641|gb|AGV02991.1| photosystem II
           protein M (chloroplast) [Pelargonium alternans]
          Length = 37

 Score = 62.8 bits (151), Expect = 1e-07
 Identities = 33/37 (89%), Positives = 34/37 (91%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND*FE 280
           MEVNILA  ATALFILVPTAFLLIIYVKTVSQ+D FE
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQSDSFE 37


>ref|YP_009040786.1| photosystem II protein M (chloroplast) (chloroplast) [Centaurea
           diffusa] gi|645101139|gb|AIB03740.1| photosystem II
           protein M (chloroplast) (chloroplast) [Centaurea
           diffusa] gi|816377431|gb|AKF00090.1| photosystem II
           protein M (chloroplast) [Orania palindan]
           gi|816377507|gb|AKF00165.1| photosystem II protein M
           (chloroplast) [Pelagodoxa henryana]
           gi|816377582|gb|AKF00239.1| photosystem II protein M
           (chloroplast) [Podococcus barteri]
           gi|816377643|gb|AKF00299.1| photosystem II protein M
           (chloroplast) [Prestoea acuminata var. montana]
           gi|816377701|gb|AKF00356.1| photosystem II protein M
           (chloroplast) [Reinhardtia gracilis]
           gi|816377777|gb|AKF00431.1| photosystem II protein M
           (chloroplast) [Reinhardtia latisecta]
           gi|816377842|gb|AKF00495.1| photosystem II protein M
           (chloroplast) [Roystonea regia]
           gi|816377984|gb|AKF00635.1| photosystem II protein M
           (chloroplast) [Reinhardtia simplex]
           gi|816378046|gb|AKF00696.1| photosystem II protein M
           (chloroplast) [Satakentia liukiuensis]
           gi|816378119|gb|AKF00768.1| photosystem II protein M
           (chloroplast) [Sclerosperma profizianum]
           gi|816378346|gb|AKF00992.1| photosystem II protein M
           (chloroplast) [Attalea speciosa]
           gi|816378423|gb|AKF01068.1| photosystem II protein M
           (chloroplast) [Bactris major]
           gi|816378500|gb|AKF01144.1| photosystem II protein M
           (chloroplast) [Beccariophoenix madagascariensis]
           gi|816378583|gb|AKF01226.1| photosystem II protein M
           (chloroplast) [Burretiokentia grandiflora]
           gi|816378648|gb|AKF01290.1| photosystem II protein M
           (chloroplast) [Dictyosperma album]
           gi|816378727|gb|AKF01368.1| photosystem II protein M
           (chloroplast) [Drymophloeus litigiosus]
           gi|816378800|gb|AKF01440.1| photosystem II protein M
           (chloroplast) [Dypsis decaryi]
           gi|816378886|gb|AKF01525.1| photosystem II protein M
           (chloroplast) [Geonoma undata subsp. dussiana]
           gi|816378962|gb|AKF01600.1| photosystem II protein M
           (chloroplast) [Heterospathe cagayanensis]
           gi|816379044|gb|AKF01681.1| photosystem II protein M
           (chloroplast) [Hydriastele microspadix]
           gi|816379211|gb|AKF01846.1| photosystem II protein M
           (chloroplast) [Kentiopsis piersoniorum]
           gi|816379276|gb|AKF01910.1| photosystem II protein M
           (chloroplast) [Leopoldinia pulchra]
           gi|816379438|gb|AKF02070.1| photosystem II protein M
           (chloroplast) [Oenocarpus bataua]
           gi|816379500|gb|AKF02131.1| photosystem II protein M
           (chloroplast) [Oenocarpus minor]
          Length = 35

 Score = 62.4 bits (150), Expect = 1e-07
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 167 IMEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           +MEVNILA  ATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 35


>ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]
           gi|11465948|ref|NP_054490.1| photosystem II protein M
           [Nicotiana tabacum] gi|11466775|ref|NP_039371.1|
           photosystem II protein M [Oryza sativa Japonica Group]
           gi|11497518|ref|NP_054926.1| photosystem II protein M
           [Spinacia oleracea] gi|28261711|ref|NP_783226.1|
           photosystem II protein M [Atropa belladonna]
           gi|50233959|ref|YP_052737.1| photosystem II protein M
           (chloroplast) [Oryza nivara]
           gi|50346776|ref|YP_053149.1| photosystem II protein M
           [Nymphaea alba] gi|75755653|ref|YP_319759.1| photosystem
           II protein M [Acorus calamus]
           gi|78102526|ref|YP_358667.1| photosystem II protein M
           [Nicotiana sylvestris] gi|78103247|ref|YP_358572.1|
           photosystem II protein M [Phalaenopsis aphrodite subsp.
           formosana] gi|81301557|ref|YP_398854.1| photosystem II
           protein M [Nicotiana tomentosiformis]
           gi|91208982|ref|YP_538842.1| photosystem II protein M
           [Solanum bulbocastanum] gi|94502477|ref|YP_588103.1|
           photosystem II protein M (chloroplast) [Helianthus
           annuus] gi|108773124|ref|YP_635633.1| photosystem II
           protein M [Solanum tuberosum]
           gi|114107040|ref|YP_740196.1| photosystem II protein M
           [Liriodendron tulipifera] gi|114329740|ref|YP_740559.1|
           photosystem II protein M [Platanus occidentalis]
           gi|115391896|ref|YP_778484.1| photosystem II protein M
           [Jasminum nudiflorum] gi|115604928|ref|YP_784380.1|
           photosystem II protein M [Drimys granadensis]
           gi|121720607|ref|YP_001001528.1| photosystem II protein
           M [Nuphar advena] gi|122893984|ref|YP_001004180.1|
           photosystem II protein M [Ranunculus macranthus]
           gi|139387246|ref|YP_001123367.1| photosystem II protein
           M [Capsella bursa-pastoris]
           gi|139388088|ref|YP_001123280.1| PSII low MW protein
           [Barbarea verna] gi|139388904|ref|YP_001123631.1|
           photosystem II protein M [Lepidium virginicum]
           gi|139389090|ref|YP_001123808.1| photosystem II protein
           M [Nasturtium officinale]
           gi|139389412|ref|YP_001123109.1| photosystem II protein
           M [Olimarabidopsis pumila]
           gi|139389795|ref|YP_001123456.1| photosystem II protein
           M [Crucihimalaya wallichii]
           gi|149390262|ref|YP_001294092.1| photosystem II protein
           M [Chloranthus spicatus]
           gi|149390348|ref|YP_001294346.1| photosystem II protein
           M [Dioscorea elephantipes]
           gi|149390436|ref|YP_001294264.1| photosystem II protein
           M [Illicium oligandrum] gi|149390534|ref|YP_001294178.1|
           photosystem II protein M [Buxus microphylla]
           gi|157325524|ref|YP_001468302.1| photosystem II protein
           M [Ipomoea purpurea] gi|161622304|ref|YP_001586176.1|
           photosystem II protein M [Acorus americanus]
           gi|161784186|ref|YP_001595502.1| PSII M protein [Lemna
           minor] gi|183217727|ref|YP_001837346.1| photosystem II
           protein M [Guizotia abyssinica]
           gi|189162265|ref|YP_001936511.1| photosystem II protein
           M [Fagopyrum esculentum subsp. ancestrale]
           gi|229577748|ref|YP_002836084.1| photosystem II protein
           M [Megaleranthis saniculifolia]
           gi|253729545|ref|YP_003029728.1| PsbM (chloroplast)
           [Bambusa oldhamii] gi|255961371|ref|YP_003097564.1|
           photosystem II protein M (chloroplast) [Dendrocalamus
           latiflorus] gi|283794962|ref|YP_003359353.1| photosystem
           II protein M (chloroplast) [Olea europaea]
           gi|289065083|ref|YP_003433969.1| photosystem II protein
           M [Typha latifolia] gi|292559503|ref|YP_003540925.1|
           photosystem II protein M [Phoenix dactylifera]
           gi|295065716|ref|YP_003587656.1| photosystem II protein
           M [Anomochloa marantoidea]
           gi|313183987|ref|YP_004021144.1| photosystem II protein
           M [Castanea mollissima] gi|330850737|ref|YP_004376415.1|
           photosystem II protein M [Olea europaea subsp. europaea]
           gi|334361943|ref|YP_004563861.1| photosystem II protein
           M [Nelumbo lutea] gi|334700276|ref|YP_004563775.1|
           photosystem II protein M [Olea europaea subsp.
           cuspidata] gi|334701613|ref|YP_004563998.1| photosystem
           II protein M [Olea woodiana subsp. woodiana]
           gi|334701788|ref|YP_004564358.1| photosystem II protein
           M (chloroplast) [Ageratina adenophora]
           gi|334701882|ref|YP_004564491.1| photosystem II protein
           M [Olea europaea subsp. maroccana]
           gi|339906441|ref|YP_004733233.1| photosystem II protein
           M (plastid) [Indocalamus longiauritus]
           gi|340034015|ref|YP_004733567.1| photosystem II protein
           M (chloroplast) [Phyllostachys edulis]
           gi|340034186|ref|YP_004733749.1| photosystem II protein
           M (chloroplast) [Acidosasa purpurea]
           gi|340034354|ref|YP_004733967.1| photosystem II protein
           M (chloroplast) [Phyllostachys nigra var. henonis]
           gi|340034439|ref|YP_004734090.1| photosystem II protein
           M (chloroplast) [Bambusa emeiensis]
           gi|340034525|ref|YP_004734174.1| photosystem II protein
           M (plastid) [Ferrocalamus rimosivaginus]
           gi|342316115|ref|YP_004769624.1| photosystem II protein
           M (chloroplast) [Spirodela polyrhiza]
           gi|342316199|ref|YP_004769708.1| photosystem II protein
           M [Magnolia kwangsiensis]
           gi|342316284|ref|YP_004769806.1| photosystem II protein
           M (chloroplast) [Wolffiella lingulata]
           gi|342316368|ref|YP_004769941.1| photosystem II protein
           M (chloroplast) [Wolffia australiana]
           gi|351653870|ref|YP_004891595.1| psbM gene product
           (chloroplast) [Nicotiana undulata]
           gi|359422255|ref|YP_004935660.1| PSII M protein
           (chloroplast) [Sesamum indicum]
           gi|364283978|ref|YP_004940504.1| psbM gene product
           (chloroplast) [Boea hygrometrica]
           gi|374249255|ref|YP_005087998.1| psbM gene product
           [Leersia tisserantii] gi|374249339|ref|YP_005088521.1|
           psbM gene product (chloroplast) [Phyllostachys
           propinqua] gi|374249608|ref|YP_005089135.1| psbM gene
           product [Rhynchoryza subulata]
           gi|374249698|ref|YP_005089328.1| psbM gene product
           (chloroplast) [Silene vulgaris]
           gi|374249780|ref|YP_005089409.1| psbM gene product
           (chloroplast) [Silene noctiflora]
           gi|374249862|ref|YP_005089490.1| psbM gene product
           (chloroplast) [Silene conica]
           gi|374249944|ref|YP_005089571.1| psbM gene product
           (chloroplast) [Silene latifolia]
           gi|377819372|ref|YP_005097868.1| photosystem II protein
           M (chloroplast) [Colocasia esculenta]
           gi|378758403|ref|YP_005296407.1| psbM gene product
           (chloroplast) [Oryza meridionalis]
           gi|383931184|ref|YP_006073098.1| photosystem II protein
           M (chloroplast) [Elaeis guineensis]
           gi|385153482|ref|YP_006073262.1| photosystem II protein
           M (chloroplast) [Phalaenopsis equestris]
           gi|386799159|ref|YP_006280748.1| psbM gene product
           (chloroplast) [Oryza rufipogon]
           gi|394831096|ref|YP_006503785.1| photosystem II M
           protein (chloroplast) [Datura stramonium]
           gi|400256582|ref|YP_006576109.1| PsbM (chloroplast)
           [Magnolia denudata] gi|404474405|ref|YP_006665774.1|
           photosystem II protein M (chloroplast) [Elodea
           canadensis] gi|404474519|ref|YP_006666024.1| photosystem
           II protein M (chloroplast) [Capsicum annuum]
           gi|435856367|ref|YP_007317242.1| PSII M protein
           (chloroplast) [Camellia sinensis]
           gi|442742957|ref|YP_007353909.1| photosystem II protein
           M (chloroplast) [Tectona grandis]
           gi|443267301|ref|YP_007375037.1| photosystem II protein
           M [Quercus rubra] gi|452848682|ref|YP_007474364.1|
           photosystem II M protein (chloroplast) [Magnolia
           officinalis] gi|452848765|ref|YP_007474446.1|
           photosystem II M protein (chloroplast) [Magnolia
           officinalis subsp. biloba]
           gi|452848850|ref|YP_007474530.1| photosystem II M
           protein (chloroplast) [Magnolia grandiflora]
           gi|452849471|ref|YP_007475128.1| photosystem II protein
           M (chloroplast) [Arundinaria gigantea]
           gi|456061445|ref|YP_007475613.1| photosystem II protein
           M [Heliconia collinsiana]
           gi|456061550|ref|YP_007475698.1| photosystem II protein
           M [Zingiber spectabile] gi|456061652|ref|YP_007475783.1|
           photosystem II protein M [Pseudophoenix vinifera]
           gi|456061764|ref|YP_007475955.1| photosystem II protein
           M [Bismarckia nobilis] gi|456061880|ref|YP_007476041.1|
           photosystem II protein M [Dasypogon bromeliifolius]
           gi|456330886|ref|YP_007475869.1| photosystem II protein
           M [Calamus caryotoides] gi|456330984|ref|YP_007476345.1|
           PsbM (chloroplast) [Trithuria inconspicua]
           gi|459014487|ref|YP_007507105.1| photosystem II M
           protein (chloroplast) [Salvia miltiorrhiza]
           gi|484759639|ref|YP_007889936.1| photosystem II protein
           M (chloroplast) [Pachycladon cheesemanii]
           gi|511348330|ref|YP_008081259.1| photosystem II protein
           M (chloroplast) (chloroplast) [Catharanthus roseus]
           gi|511348432|ref|YP_008081359.1| photosystem II protein
           M (chloroplast) [Tetracentron sinense]
           gi|511348525|ref|YP_008081451.1| photosystem II protein
           M (chloroplast) [Trochodendron aralioides]
           gi|519704498|ref|YP_008082575.1| photosystem II protein
           M (chloroplast) [Utricularia gibba]
           gi|529249791|ref|YP_008378780.1| photosystem II protein
           M (chloroplast) [Najas flexilis]
           gi|542688193|ref|YP_008520133.1| photosystem II protein
           M (chloroplast) [Camellia taliensis]
           gi|544163607|ref|YP_008563082.1| photosystem II protein
           M (chloroplast) [Solanum lycopersicum]
           gi|546138053|ref|YP_008578279.1| photosystem II protein
           M (chloroplast) [Cocos nucifera]
           gi|552539667|ref|YP_008592751.1| photosystem II protein
           M (chloroplast) [Camellia cuspidata]
           gi|552540912|ref|YP_008592840.1| photosystem II protein
           M (chloroplast) [Camellia danzaiensis]
           gi|552541009|ref|YP_008592927.1| photosystem II protein
           M (chloroplast) [Camellia impressinervis]
           gi|552541103|ref|YP_008593105.1| photosystem II protein
           M (chloroplast) [Camellia yunnanensis]
           gi|552541297|ref|YP_008592482.1| PSII M protein
           (chloroplast) [Andrographis paniculata]
           gi|552546262|ref|YP_008593016.1| photosystem II protein
           M (chloroplast) [Camellia pitardii]
           gi|558603860|ref|YP_008815931.1| photosystem II protein
           M (chloroplast) [Lindenbergia philippensis]
           gi|563940546|ref|YP_008854419.1| photosystem II protein
           M [Musa textilis] gi|563940649|ref|YP_008854505.1|
           photosystem II protein M [Ravenala madagascariensis]
           gi|567853685|ref|YP_008854588.1| photosystem II protein
           M [Curcuma roscoeana] gi|568244553|ref|YP_008963300.1|
           photosystem II protein M [Camellia oleifera]
           gi|568244728|ref|YP_008963474.1| photosystem II protein
           M (chloroplast) [Penthorum chinense]
           gi|568245193|ref|YP_008964343.1| photosystem II protein
           M [Helianthus divaricatus]
           gi|568245279|ref|YP_008964428.1| photosystem II protein
           M [Helianthus decapetalus]
           gi|568245365|ref|YP_008964683.1| photosystem II protein
           M [Helianthus strumosus]
           gi|568245451|ref|YP_008964768.1| photosystem II protein
           M [Helianthus maximiliani]
           gi|568247097|ref|YP_008964028.1| photosystem II protein
           M [Ajuga reptans] gi|568247143|ref|YP_008964173.1|
           photosystem II protein M [Helianthus giganteus]
           gi|568247229|ref|YP_008964258.1| photosystem II protein
           M [Helianthus grosseserratus]
           gi|568247315|ref|YP_008964513.1| photosystem II protein
           M [Helianthus hirsutus] gi|568247401|ref|YP_008964598.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|570700303|ref|YP_008993963.1| photosystem II protein
           M (chloroplast) [Pharus lappulaceus]
           gi|575669204|ref|YP_008964861.1| photosystem II protein
           M (chloroplast) [Schwalbea americana]
           gi|575925624|ref|YP_009000009.1| photosystem II protein
           M (chloroplast) (chloroplast) [Silene conoidea]
           gi|576312286|ref|YP_009000170.1| photosystem II protein
           M (chloroplast) (chloroplast) [Silene paradoxa]
           gi|576999541|ref|YP_009000090.1| photosystem II protein
           M (chloroplast) (chloroplast) [Silene chalcedonica]
           gi|586929220|ref|YP_009001981.1| photosystem II protein
           M (chloroplast) [Puelia olyriformis]
           gi|587005072|ref|YP_009002252.1| photosystem II protein
           M (chloroplast) [Pinguicula ehlersiae]
           gi|595789931|ref|YP_009020214.1| photosystem II protein
           M (chloroplast) [Castanopsis echinocarpa]
           gi|598324111|ref|YP_009020729.1| photosystem II protein
           M (chloroplast) [Praxelis clematidea]
           gi|608787546|ref|YP_009024243.1| photosystem II protein
           M (chloroplast) [Arundinaria appalachiana]
           gi|608787630|ref|YP_009024326.1| photosystem II protein
           M (chloroplast) [Arundinaria tecta]
           gi|609253108|ref|YP_009024787.1| photosystem II protein
           M (chloroplast) [Trigonobalanus doichangensis]
           gi|619275730|ref|YP_009026875.1| photosystem II protein
           M (plastid) [Magnolia tripetala]
           gi|642276434|ref|YP_009033432.1| photosystem II protein
           M (plastid) [Olyra latifolia]
           gi|649132472|ref|YP_009034085.1| photosystem II protein
           M (plastid) [Oryza glaberrima]
           gi|651249263|ref|YP_009033879.1| photosystem II protein
           M (plastid) [Dioscorea rotundata]
           gi|657302690|ref|YP_009040312.1| photosystem II protein
           M [Hyoscyamus niger] gi|657302854|ref|YP_009041081.1|
           photosystem II protein M [Rhazya stricta]
           gi|669100064|ref|YP_009047926.1| photosystem II protein
           M (chloroplast) [Camellia crapnelliana]
           gi|669100153|ref|YP_009048015.1| photosystem II protein
           M (chloroplast) [Nymphaea mexicana]
           gi|669100425|ref|YP_009048281.1| photosystem II protein
           M (chloroplast) [Magnolia yunnanensis]
           gi|669136033|ref|YP_009049257.1| photosystem II protein
           M (chloroplast) [Oryza australiensis]
           gi|671741924|ref|YP_009050582.1| photosystem II protein
           M (chloroplast) [Camellia grandibracteata]
           gi|671742012|ref|YP_009050669.1| photosystem II protein
           M (chloroplast) [Camellia leptophylla]
           gi|671743225|ref|YP_009050756.1| photosystem II protein
           M (chloroplast) [Camellia petelotii]
           gi|671743313|ref|YP_009050843.1| photosystem II protein
           M (chloroplast) [Camellia pubicosta]
           gi|671743401|ref|YP_009050930.1| photosystem II protein
           M (chloroplast) [Camellia reticulata]
           gi|671743687|ref|YP_009051239.1| photosystem II protein
           M (chloroplast) [Bambusa multiplex]
           gi|671743773|ref|YP_009051324.1| photosystem II protein
           M (chloroplast) [Phyllostachys sulphurea]
           gi|675154051|ref|YP_009052573.1| photosystem II protein
           M (chloroplast) [Arundinaria fargesii]
           gi|675154135|ref|YP_009052656.1| photosystem II protein
           M (chloroplast) [Sarocalamus faberi]
           gi|675154220|ref|YP_009052740.1| photosystem II protein
           M (chloroplast) [Chimonocalamus longiusculus]
           gi|675154303|ref|YP_009052822.1| photosystem II protein
           M (chloroplast) [Fargesia nitida]
           gi|675154387|ref|YP_009052905.1| photosystem II protein
           M (chloroplast) [Fargesia spathacea]
           gi|675154471|ref|YP_009052988.1| photosystem II protein
           M (chloroplast) [Fargesia yunnanensis]
           gi|675154555|ref|YP_009053071.1| photosystem II protein
           M (chloroplast) [Gaoligongshania megalothyrsa]
           gi|675154639|ref|YP_009053154.1| photosystem II protein
           M (chloroplast) [Gelidocalamus tessellatus]
           gi|675154723|ref|YP_009053237.1| photosystem II protein
           M (chloroplast) [Indocalamus wilsonii]
           gi|675154807|ref|YP_009053320.1| photosystem II protein
           M (chloroplast) [Indosasa sinica]
           gi|675154890|ref|YP_009053402.1| photosystem II protein
           M (chloroplast) [Oligostachyum shiuyingianum]
           gi|675154973|ref|YP_009053649.1| photosystem II protein
           M (chloroplast) [Yushania levigata]
           gi|675155309|ref|YP_009053484.1| photosystem II protein
           M (chloroplast) [Pleioblastus maculatus]
           gi|675155414|ref|YP_009053566.1| photosystem II protein
           M (chloroplast) [Thamnocalamus spathiflorus]
           gi|675155498|ref|YP_009053868.1| photosystem II protein
           M (plastid) [Ampelocalamus calcareus]
           gi|700491224|ref|YP_009093944.1| photosystem II protein
           M (chloroplast) [Nelumbo nucifera]
           gi|712911793|ref|YP_009092761.1| photosystem II protein
           M [Bomarea edulis] gi|712912040|ref|YP_009093794.1|
           photosystem II protein M (chloroplast) [Luzuriaga
           radicans] gi|723456742|ref|YP_009108435.1| photosystem
           II protein M (chloroplast) [Genlisea margaretae]
           gi|723457519|ref|YP_009107557.1| photosystem II protein
           M (chloroplast) [Phalaenopsis hybrid cultivar]
           gi|728792370|ref|YP_009108492.1| photosystem II protein
           M (chloroplast) [Utricularia macrorhiza]
           gi|731971825|ref|YP_009110596.1| photosystem II protein
           M (chloroplast) [Hesperelaea palmeri]
           gi|745998933|ref|YP_009108668.1| photosystem II protein
           M [Nerium oleander] gi|746948464|ref|YP_009114863.1|
           photosystem II protein M [Thalictrum coreanum]
           gi|751425710|ref|YP_009116336.1| photosystem II protein
           M (chloroplast) [Ananas comosus]
           gi|752789780|ref|YP_009117215.1| photosystem II protein
           M (chloroplast) [Premna microphylla]
           gi|756877466|ref|YP_009117669.1| photosystem II protein
           M [Acorus gramineus] gi|772650068|ref|YP_009128065.1|
           photosystem II protein M (chloroplast) [Actinidia
           deliciosa] gi|772657434|ref|YP_009128175.1| photosystem
           II protein M (chloroplast) [Saracha punctata]
           gi|772657550|ref|YP_009128385.1| photosystem II protein
           M (chloroplast) [Ipomoea batatas]
           gi|772657834|ref|YP_009128834.1| photosystem II protein
           M (chloroplast) [Iochroma loxense]
           gi|788229400|ref|YP_009123246.1| photosystem II protein
           M (chloroplast) [Chloranthus japonicus]
           gi|788229461|ref|YP_009123627.1| photosystem II protein
           M (chloroplast) [Iochroma stenanthum]
           gi|788229564|ref|YP_009123736.1| photosystem II protein
           M [Lithocarpus balansae]
           gi|788229776|ref|YP_009127982.1| photosystem II protein
           M (chloroplast) [Actinidia chinensis]
           gi|788512373|ref|YP_009123151.1| photosystem II protein
           M (chloroplast) [Dunalia obovata]
           gi|803360232|ref|YP_009123345.1| photosystem II protein
           M (chloroplast) [Iochroma nitidum]
           gi|810932457|ref|YP_009129354.1| photosystem II protein
           M (chloroplast) [Cypripedium formosanum]
           gi|810932742|ref|YP_009130121.1| photosystem II protein
           M (chloroplast) [Carludovica palmata]
           gi|810932939|ref|YP_009130316.1| photosystem II protein
           M (chloroplast) [Quercus aliena]
           gi|813424012|ref|YP_009131707.1| photosystem II protein
           M (chloroplast) [Solanum cheesmaniae]
           gi|813424117|ref|YP_009131956.1| photosystem II protein
           M (chloroplast) [Solanum habrochaites]
           gi|813424262|ref|YP_009132039.1| photosystem II protein
           M (chloroplast) [Solanum neorickii]
           gi|813427265|ref|YP_009132830.1| photosystem II protein
           M (chloroplast) [Quercus spinosa]
           gi|813428096|ref|YP_009133049.1| photosystem II protein
           M (chloroplast) [Quercus aquifolioides]
           gi|813559403|ref|YP_009131790.1| photosystem II protein
           M (chloroplast) [Solanum chilense]
           gi|813559487|ref|YP_009131873.1| photosystem II protein
           M (chloroplast) [Solanum galapagense]
           gi|813559571|ref|YP_009132122.1| photosystem II protein
           M (chloroplast) [Solanum peruvianum]
           gi|813559655|ref|YP_009132205.1| photosystem II protein
           M (chloroplast) [Solanum pimpinellifolium]
           gi|813559795|ref|YP_009132746.1| photosystem II protein
           M (chloroplast) [Dunalia brachyacantha]
           gi|814071379|ref|YP_009120911.1| photosystem II protein
           M (plastid) [Sabal domingensis]
           gi|814071467|ref|YP_009120997.1| photosystem II protein
           M (plastid) [Cardamine impatiens]
           gi|814071553|ref|YP_009121082.1| photosystem II protein
           M (plastid) [Cardamine resedifolia]
           gi|814071779|ref|YP_009122858.1| photosystem II protein
           M (chloroplast) [Capsicum lycianthoides]
           gi|814071948|ref|YP_009123519.1| photosystem II protein
           M (plastid) [Physalis peruviana]
           gi|817524696|ref|YP_009134769.1| photosystem II protein
           M (plastid) [Bambusa bambos]
           gi|817524781|ref|YP_009134852.1| photosystem II protein
           M (plastid) [Bambusa arnhemica]
           gi|817524865|ref|YP_009134935.1| photosystem II protein
           M (plastid) [Chusquea spectabilis]
           gi|817524952|ref|YP_009135018.1| photosystem II protein
           M (plastid) [Diandrolyra sp. Clark 1301]
           gi|817525043|ref|YP_009135098.1| photosystem II protein
           M (plastid) [Greslania sp. McPherson 19217]
           gi|817525133|ref|YP_009135181.1| photosystem II protein
           M (plastid) [Hickelia madagascariensis]
           gi|817525221|ref|YP_009135264.1| photosystem II protein
           M (plastid) [Neohouzeaua sp. Clark & Attigala 1712]
           gi|817525308|ref|YP_009135347.1| photosystem II protein
           M (plastid) [Neololeba atra]
           gi|817525399|ref|YP_009135430.1| photosystem II protein
           M (plastid) [Olmeca reflexa]
           gi|817525487|ref|YP_009135513.1| photosystem II protein
           M (plastid) [Raddia brasiliensis]
           gi|817525668|ref|YP_009135681.1| photosystem II protein
           M (plastid) [Buergersiochloa bambusoides]
           gi|817525756|ref|YP_009135764.1| photosystem II protein
           M (plastid) [Chusquea liebmannii]
           gi|817525872|ref|YP_009135846.1| photosystem II protein
           M (plastid) [Lithachne pauciflora]
           gi|817525993|ref|YP_009135926.1| photosystem II protein
           M (plastid) [Otatea acuminata]
           gi|817526137|ref|YP_009136009.1| photosystem II protein
           M (plastid) [Pariana radiciflora]
           gi|817530137|ref|YP_009136726.1| photosystem II protein
           M (plastid) [Guadua weberbaueri]
           gi|821318020|ref|YP_009139095.1| photosystem II protein
           M (chloroplast) [Dioscorea zingiberensis]
           gi|821318328|ref|YP_009139462.1| photosystem II protein
           M (chloroplast) [Dunalia solanacea]
           gi|821318654|ref|YP_009139774.1| photosystem II protein
           M (chloroplast) [Cynara humilis]
           gi|827045525|ref|YP_009141857.1| photosystem II protein
           M (chloroplast) [Xerophyllum tenax]
           gi|827045613|ref|YP_009141944.1| photosystem II protein
           M (chloroplast) [Heloniopsis tubiflora]
           gi|827045715|ref|YP_009142044.1| PsbM (chloroplast)
           [Fagopyrum tataricum] gi|827046009|ref|YP_009142320.1|
           photosystem II protein M (chloroplast) [Iochroma
           tingoanum] gi|827046175|ref|YP_009142477.1| photosystem
           II protein M (chloroplast) [Chikusichloa aquatica]
           gi|836614461|ref|YP_009145098.1| photosystem II protein
           M (chloroplast) [Podococcus barteri]
           gi|836642880|ref|YP_009143883.1| photosystem II protein
           M (plastid) [Cypripedium japonicum]
           gi|836643252|ref|YP_009144316.1| photosystem II protein
           M (plastid) [Carex siderosticta]
           gi|836643453|ref|YP_009144509.1| PSII M protein
           (chloroplast) [Rosmarinus officinalis]
           gi|836643762|ref|YP_009144973.1| photosystem II protein
           M (chloroplast) [Dieffenbachia seguine]
           gi|884997804|ref|YP_009155529.1| photosystem II protein
           M (chloroplast) [Oryza barthii]
           gi|884997888|ref|YP_009155611.1| photosystem II protein
           M (chloroplast) [Oryza glumipatula]
           gi|884997972|ref|YP_009155694.1| photosystem II protein
           M (chloroplast) [Oryza longistaminata]
           gi|884998056|ref|YP_009155777.1| photosystem II protein
           M (chloroplast) [Oryza officinalis]
           gi|884998423|ref|YP_009156194.1| photosystem II protein
           M (plastid) [Avena sativa]
           gi|884998591|ref|YP_009156362.1| photosystem II protein
           M (plastid) [Brachyelytrum aristosum]
           gi|884998932|ref|YP_009156697.1| photosystem II protein
           M (plastid) [Diarrhena obovata]
           gi|884999184|ref|YP_009156946.1| photosystem II protein
           M (plastid) [Melica mutica]
           gi|884999268|ref|YP_009157029.1| photosystem II protein
           M (plastid) [Melica subulata]
           gi|884999437|ref|YP_009157196.1| photosystem II protein
           M (plastid) [Phaenosperma globosum]
           gi|884999521|ref|YP_009157280.1| photosystem II protein
           M (plastid) [Phalaris arundinacea]
           gi|885000141|ref|YP_009157891.1| photosystem II protein
           M (plastid) [Chusquea circinata]
           gi|885000226|ref|YP_009157975.1| photosystem II protein
           M (plastid) [Pariana campestris]
           gi|885001496|ref|YP_009154772.1| photosystem II protein
           M (chloroplast) [Aster spathulifolius]
           gi|902687190|ref|YP_009159820.1| photosystem II protein
           M (chloroplast) [Carnegiea gigantea]
           gi|910312594|ref|YP_009162255.1| photosystem II M
           protein (chloroplast) [Scutellaria baicalensis]
           gi|910354915|ref|YP_009161178.1| PsbM (chloroplast)
           [Oryza punctata] gi|910355243|ref|YP_009161352.1| PsbM
           (chloroplast) [Oryza sativa Indica Group]
           gi|910355721|ref|YP_009161548.1| photosystem II protein
           M (chloroplast) [Pinellia ternata]
           gi|910356036|ref|YP_009161915.1| photosystem II protein
           M (chloroplast) [Capsella rubella]
           gi|918020469|ref|YP_009162871.1| photosystem II protein
           M (chloroplast) [Rheum palmatum]
           gi|927372292|ref|YP_009164575.1| photosystem II protein
           M (chloroplast) [Lathraea squamaria]
           gi|937408417|ref|YP_009166599.1| photosystem II protein
           M (chloroplast) [Epipremnum aureum]
           gi|937408504|ref|YP_009166685.1| photosystem II protein
           M (chloroplast) [Tanaecium tetragonolobum]
           gi|937546356|ref|YP_009169350.1| photosystem II protein
           M (chloroplast) [Clematis terniflora]
           gi|937546491|ref|YP_009169480.1| photosystem II protein
           M (chloroplast) [Cynara baetica]
           gi|937546579|ref|YP_009169567.1| photosystem II protein
           M (chloroplast) [Cynara cornigera]
           gi|937546676|ref|YP_009169662.1| PsbM (chloroplast)
           [Capsicum frutescens] gi|937547202|ref|YP_009170171.1|
           photosystem II protein M (plastid) [Colpothrinax cookii]
           gi|938339666|ref|YP_009171776.1| PsbM (chloroplast)
           [Solanum commersonii] gi|938339775|ref|YP_009171862.1|
           PsbM (chloroplast) [Solanum nigrum]
           gi|938340373|ref|YP_009172271.1| photosystem II protein
           M (chloroplast) [Colobanthus quitensis]
           gi|944541389|ref|YP_009175267.1| photosystem II protein
           M (chloroplast) [Phragmipedium longifolium]
           gi|948299185|ref|YP_009178652.1| photosystem II protein
           M (chloroplast) [Pseudosasa japonica]
           gi|948299623|ref|YP_009179050.1| photosystem II protein
           M (chloroplast) [Ostrya rehderiana]
           gi|953244818|ref|YP_009179946.1| photosystem II protein
           M (chloroplast) [Bletilla striata]
           gi|953358194|ref|YP_009180365.1| photosystem II protein
           M (chloroplast) [Musa balbisiana]
           gi|544170665|ref|AP_004922.1| photosystem II protein M
           (chloroplast) [Solanum lycopersicum]
           gi|49065803|sp|P62109.1|PSBM_ARATH RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|49065805|sp|P62111.1|PSBM_TOBAC RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Nicotiana tabacum]
           gi|49065806|sp|P62112.1|PSBM_SPIOL RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Spinacia oleracea]
           gi|61214668|sp|Q5IBK3.1|PSBM_PLALA RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Plantago lanceolata]
           gi|61214952|sp|Q6ENI6.1|PSBM_ORYNI RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|61214968|sp|Q6EW54.1|PSBM_NYMAL RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Nymphaea alba]
           gi|61215132|sp|Q7FNT0.1|PSBM_ATRBE RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Atropa belladonna]
           gi|122164447|sp|Q06H03.1|PSBM_DRIGR RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Drimys granadensis]
           gi|122164979|sp|Q06RD7.1|PSBM_JASNU RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Jasminum nudiflorum]
           gi|122166041|sp|Q09G52.1|PSBM_PLAOC RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Platanus occidentalis]
           gi|122179586|sp|Q1KXX3.1|PSBM_HELAN RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Helianthus annuus]
           gi|122201791|sp|Q2MIA6.1|PSBM_SOLLC RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122201833|sp|Q2MIJ3.1|PSBM_SOLBU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Solanum bulbocastanum]
           gi|122209898|sp|Q2VEI2.1|PSBM_SOLTU RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122212913|sp|Q33C43.1|PSBM_NICTO
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Nicotiana tomentosiformis]
           gi|122213441|sp|Q3BAP6.1|PSBM_PHAAO RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Phalaenopsis aphrodite
           subsp. formosana] gi|122213539|sp|Q3C1G4.1|PSBM_NICSY
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Nicotiana sylvestris]
           gi|122217422|sp|Q3V540.1|PSBM_ACOCL RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Acorus calamus]
           gi|122233821|sp|Q0G9M5.1|PSBM_LIRTU RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Liriodendron tulipifera]
           gi|148887148|sp|P0C411.1|PSBM_ORYSA RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|148887149|sp|P0C412.1|PSBM_ORYSI
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|148887150|sp|P0C413.1|PSBM_ORYSJ
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|171769948|sp|A7Y3C1.1|PSBM_IPOPU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Ipomoea purpurea]
           gi|172044402|sp|A4QJS7.1|PSBM_OLIPU RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Olimarabidopsis pumila]
           gi|172044406|sp|A4QK99.1|PSBM_BARVE RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044408|sp|A4QKI6.1|PSBM_CAPBU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Capsella bursa-pastoris]
           gi|172044410|sp|A4QKS5.1|PSBM_CRUWA RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Crucihimalaya wallichii]
           gi|172044414|sp|A4QLA0.1|PSBM_LEPVR RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Lepidium virginicum]
           gi|172044418|sp|A4QLS7.1|PSBM_NASOF RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Nasturtium officinale]
           gi|172048415|sp|A9L990.1|PSBM_LEMMI RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Lemna minor]
           gi|172048676|sp|A6MM30.1|PSBM_BUXMI RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Buxus microphylla]
           gi|172048685|sp|A6MMB6.1|PSBM_CHLSC RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Chloranthus spicatus]
           gi|172048694|sp|A6MMK1.1|PSBM_DIOEL RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Dioscorea elephantipes]
           gi|172048703|sp|A6MMT8.1|PSBM_ILLOL RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M (chloroplast) [Illicium oligandrum]
           gi|19920159|gb|AAM08591.1|AC092750_25 Putative PSII low
           MW protein from chromosome 10 chloroplast insertion
           [Oryza sativa Japonica Group]
           gi|21327351|gb|AAM48256.1|AC122148_9 Putative PSII low
           MW protein from chromosome 10 chloroplast insertion
           [Oryza sativa Japonica Group] gi|11969|emb|CAA33984.1|
           PSII low MW protein (chloroplast) [Oryza sativa Japonica
           Group] gi|2924261|emb|CAA77413.1| PSII M-protein
           [Nicotiana tabacum] gi|5881688|dbj|BAA84379.1| PSII low
           MW protein [Arabidopsis thaliana]
           gi|7636099|emb|CAB88719.1| PSII M-protein (chloroplast)
           [Spinacia oleracea] gi|20068325|emb|CAC88038.1| PSII M
           protein [Atropa belladonna] gi|21628656|emb|CAD36619.1|
           photosystem II polypeptide M [Quercus petraea]
           gi|49614983|dbj|BAD26766.1| PSII low MW protein
           (chloroplast) [Oryza nivara] gi|50250321|emb|CAF28587.1|
           PSII low MW protein [Nymphaea alba]
           gi|57115540|gb|AAW33074.1| photosystem II protein M
           [Plantago australis] gi|57115543|gb|AAW33076.1|
           photosystem II protein M [Plantago coronopus]
           gi|57115546|gb|AAW33078.1| photosystem II protein M
           [Plantago lanceolata] gi|57115549|gb|AAW33080.1|
           photosystem II protein M [Plantago media]
           gi|57115552|gb|AAW33082.1| photosystem II protein M
           [Plantago rigida] gi|57115555|gb|AAW33084.1| photosystem
           II protein M [Plantago rugelii]
           gi|58802777|gb|AAW82497.1| photosystem II M protein
           [Phalaenopsis aphrodite subsp. formosana]
           gi|69217310|gb|AAZ04027.1| photosystem II protein M
           [Acorus americanus] gi|69217314|gb|AAZ04029.1|
           photosystem II protein M [Nuphar advena]
           gi|69217316|gb|AAZ04030.1| photosystem II protein M
           [Ranunculus macranthus] gi|69217318|gb|AAZ04031.1|
           photosystem II protein M [Typha latifolia]
           gi|72011389|gb|AAZ66142.1| PsbM (chloroplast) [Symplocos
           chinensis] gi|72011392|gb|AAZ66144.1| PsbM (chloroplast)
           [Symplocos paniculata] gi|72011398|gb|AAZ66148.1| PsbM
           (chloroplast) [Symplocos celastrinea]
           gi|72011404|gb|AAZ66152.1| PsbM (chloroplast) [Symplocos
           pentandra] gi|72011410|gb|AAZ66156.1| PsbM (chloroplast)
           [Symplocos tinctoria] gi|72011413|gb|AAZ66158.1| PsbM
           (chloroplast) [Symplocos lanata]
           gi|72011419|gb|AAZ66162.1| PsbM (chloroplast) [Symplocos
           austin-smithii] gi|72011422|gb|AAZ66164.1| PsbM
           (chloroplast) [Symplocos austin-smithii]
           gi|72011425|gb|AAZ66166.1| PsbM (chloroplast) [Symplocos
           austromexicana] gi|72011428|gb|AAZ66168.1| PsbM
           (chloroplast) [Symplocos berteroi]
           gi|72011431|gb|AAZ66170.1| PsbM (chloroplast) [Symplocos
           breedlovei] gi|72011434|gb|AAZ66172.1| PsbM
           (chloroplast) [Symplocos citrea]
           gi|72011437|gb|AAZ66174.1| PsbM (chloroplast) [Symplocos
           coccinea] gi|72011440|gb|AAZ66176.1| PsbM (chloroplast)
           [Symplocos costaricana] gi|72011443|gb|AAZ66178.1| PsbM
           (chloroplast) [Symplocos fuscata]
           gi|72011446|gb|AAZ66180.1| PsbM (chloroplast) [Symplocos
           hartwegii] gi|72011449|gb|AAZ66182.1| PsbM (chloroplast)
           [Symplocos limoncillo] gi|72011452|gb|AAZ66184.1| PsbM
           (chloroplast) [Symplocos martinicensis]
           gi|72011455|gb|AAZ66186.1| PsbM (chloroplast) [Symplocos
           matudae] gi|72011458|gb|AAZ66188.1| PsbM (chloroplast)
           [Symplocos nitens] gi|72011461|gb|AAZ66190.1| PsbM
           (chloroplast) [Symplocos povedae]
           gi|72011470|gb|AAZ66196.1| PsbM (chloroplast) [Symplocos
           reflexa] gi|72011473|gb|AAZ66198.1| PsbM (chloroplast)
           [Symplocos serrulata] gi|72011482|gb|AAZ66204.1| PsbM
           (chloroplast) [Symplocos sp. Clark et al. 8252]
           gi|72011488|gb|AAZ66208.1| PsbM (chloroplast) [Symplocos
           striata] gi|72011491|gb|AAZ66210.1| PsbM (chloroplast)
           [Symplocos sulcinervia] gi|72011497|gb|AAZ66214.1| PsbM
           (chloroplast) [Symplocos tribracteolata]
           gi|72011500|gb|AAZ66216.1| PsbM (chloroplast) [Symplocos
           uniflora] gi|72011503|gb|AAZ66218.1| PsbM (chloroplast)
           [Symplocos verrucisurcula] gi|72011506|gb|AAZ66220.1|
           PsbM (chloroplast) [Symplocos candelabra]
           gi|72011509|gb|AAZ66222.1| PsbM (chloroplast) [Symplocos
           falcata] gi|72011512|gb|AAZ66224.1| PsbM (chloroplast)
           [Symplocos falcata] gi|72011515|gb|AAZ66226.1| PsbM
           (chloroplast) [Symplocos organensis]
           gi|72011518|gb|AAZ66228.1| PsbM (chloroplast) [Symplocos
           microstyla] gi|72011524|gb|AAZ66232.1| PsbM
           (chloroplast) [Symplocos dryophila]
           gi|72011527|gb|AAZ66234.1| PsbM (chloroplast) [Symplocos
           lancifolia] gi|72011530|gb|AAZ66236.1| PsbM
           (chloroplast) [Symplocos macrophylla]
           gi|72011539|gb|AAZ66242.1| PsbM (chloroplast) [Symplocos
           ovatilobata] gi|72011554|gb|AAZ66252.1| PsbM
           (chloroplast) [Symplocos phyllocalyx]
           gi|72011557|gb|AAZ66254.1| PsbM (chloroplast) [Symplocos
           setchuensis] gi|72011560|gb|AAZ66256.1| PsbM
           (chloroplast) [Symplocos tetragona]
           gi|72011563|gb|AAZ66258.1| PsbM (chloroplast) [Symplocos
           arborea] gi|72011578|gb|AAZ66268.1| PsbM (chloroplast)
           [Symplocos sumuntia] gi|72011584|gb|AAZ66272.1| PsbM
           (chloroplast) [Symplocos adenophylla]
           gi|72011587|gb|AAZ66274.1| PsbM (chloroplast) [Symplocos
           congesta] gi|72011590|gb|AAZ66276.1| PsbM (chloroplast)
           [Symplocos euryoides] gi|72011599|gb|AAZ66282.1| PsbM
           (chloroplast) [Symplocos glomerata]
           gi|72011602|gb|AAZ66284.1| PsbM (chloroplast) [Symplocos
           grandis] gi|72011605|gb|AAZ66286.1| PsbM (chloroplast)
           [Symplocos stellaris] gi|72011608|gb|AAZ66288.1| PsbM
           (chloroplast) [Symplocos caerulescens]
           gi|74381703|emb|CAI53788.1| PSII low MW protein [Acorus
           calamus] gi|77799553|dbj|BAE46642.1| PSII M-protein
           [Nicotiana sylvestris] gi|80750916|dbj|BAE47992.1| PSII
           M-protein [Nicotiana tomentosiformis]
           gi|82754623|gb|ABB90037.1| photosystem II M protein
           [Solanum tuberosum] gi|84371889|gb|ABC56207.1|
           photosystem II protein M [Solanum bulbocastanum]
           gi|84371977|gb|ABC56294.1| photosystem II protein M
           (chloroplast) [Solanum lycopersicum]
           gi|84682198|gb|ABC60452.1| photosystem II protein M
           (chloroplast) [Nuphar advena] gi|85540798|gb|ABC70750.1|
           photosystem II protein M (chloroplast) [Ranunculus
           macranthus] gi|88656798|gb|ABD47051.1| photosystem II
           protein M (chloroplast) [Solanum tuberosum]
           gi|88656881|gb|ABD47132.1| photosystem II protein M
           (chloroplast) [Helianthus annuus]
           gi|88696764|gb|ABD48489.1| PSII M protein (chloroplast)
           [Lemna minor] gi|89241665|emb|CAJ32387.1| photosystem II
           protein M [Solanum lycopersicum]
           gi|110456217|gb|ABG74622.1| PSII M protein (chloroplast)
           [Jasminum nudiflorum] gi|112032656|gb|ABH88291.1|
           photosystem II protein M (chloroplast) [Drimys
           granadensis] gi|113200988|gb|ABI32503.1| photosystem II
           protein M [Liriodendron tulipifera]
           gi|114054378|gb|ABI49772.1| photosystem II protein M
           (chloroplast) [Platanus occidentalis]
           gi|134286306|dbj|BAF49933.1| PSII low MW protein
           [Olimarabidopsis pumila] gi|134286479|dbj|BAF50104.1|
           PSII low MW protein [Barbarea verna]
           gi|134286567|dbj|BAF50191.1| PSII low MW protein
           [Capsella bursa-pastoris] gi|134286657|dbj|BAF50280.1|
           PSII low MW protein [Crucihimalaya wallichii]
           gi|134286834|dbj|BAF50455.1| PSII low MW protein
           [Lepidium virginicum] gi|134287013|dbj|BAF50632.1| PSII
           low MW protein [Nasturtium officinale]
           gi|146744182|gb|ABQ43254.1| photosystem II protein M
           (chloroplast) [Chloranthus spicatus]
           gi|146762279|gb|ABQ45243.1| photosystem II protein M
           [Buxus microphylla] gi|147917389|gb|ABQ52513.1|
           photosystem II protein M [Illicium oligandrum]
           gi|148668040|gb|ABR01424.1| photosystem II protein M
           [Dioscorea elephantipes] gi|156598156|gb|ABU85342.1|
           photosystem II protein M [Elaeis oleifera]
           gi|156598348|gb|ABU85434.1| photosystem II protein M
           [Musa acuminata] gi|156598649|gb|ABU85580.1| photosystem
           II protein M [Scaevola aemula]
           gi|157056752|gb|ABV02342.1| photosystem II protein M
           [Ipomoea purpurea] gi|160369847|gb|ABX38738.1|
           photosystem II protein M (chloroplast) [Acorus
           americanus] gi|166065351|gb|ABY79726.1| photosystem II
           protein M (chloroplast) [Fagopyrum esculentum subsp.
           ancestrale] gi|179366242|gb|ACB86513.1| photosystem II
           protein M [Guizotia abyssinica]
           gi|224474128|gb|ACN49317.1| photosystem II protein M
           (chloroplast) [Nelumbo lutea]
           gi|224474216|gb|ACN49402.1| photosystem II protein M
           (chloroplast) [Nelumbo nucifera]
           gi|226933876|gb|ACO92009.1| photosystem II protein M
           (chloroplast) [Megaleranthis saniculifolia]
           gi|246367055|gb|ACS94666.1| PsbM (chloroplast) [Bambusa
           oldhamii] gi|251765240|gb|ACT15394.1| photosystem II
           protein M [Anomochloa marantoidea]
           gi|255040248|gb|ACT99908.1| photosystem II protein M
           (chloroplast) [Dendrocalamus latiflorus]
           gi|281371766|gb|ADA63693.1| photosystem II protein M
           [Typha latifolia] gi|281428681|gb|ADA69920.1|
           photosystem II protein M (chloroplast) [Olea europaea]
           gi|290488066|gb|ADD30417.1| photosystem II protein M
           (chloroplast) [Antirrhinum majus]
           gi|290488070|gb|ADD30419.1| photosystem II protein M
           (chloroplast) [Dillenia indica]
           gi|290488072|gb|ADD30420.1| photosystem II protein M
           (chloroplast) [Ehretia acuminata]
           gi|290488074|gb|ADD30421.1| photosystem II protein M
           (chloroplast) [Ilex cornuta] gi|290488078|gb|ADD30423.1|
           photosystem II protein M (chloroplast) [Meliosma aff.
           cuneifolia Moore 333] gi|290488080|gb|ADD30424.1|
           photosystem II protein M (chloroplast) [Nelumbo
           nucifera] gi|290488082|gb|ADD30425.1| photosystem II
           protein M (chloroplast) [Nerium oleander]
           gi|290488090|gb|ADD30429.1| photosystem II protein M
           (chloroplast) [Berberidopsis corallina]
           gi|290488100|gb|ADD30434.1| photosystem II protein M
           (chloroplast) [Gunnera manicata]
           gi|290488106|gb|ADD30437.1| photosystem II protein M
           (chloroplast) [Oxalis latifolia]
           gi|290488110|gb|ADD30439.1| photosystem II protein M
           (chloroplast) [Quercus nigra]
           gi|290488114|gb|ADD30441.1| photosystem II protein M
           (chloroplast) [Trochodendron aralioides]
           gi|290790911|gb|ADD63166.1| photosystem II protein M
           (chloroplast) [Phoenix dactylifera]
           gi|291059247|gb|ADD72083.1| photosystem II protein M
           (chloroplast) [Olea europaea]
           gi|294620571|gb|ADF28140.1| photosystem II protein M
           (chloroplast) [Phoenix dactylifera]
           gi|302424174|gb|ADL39050.1| photosystem II protein M
           [Magnolia kwangsiensis] gi|307133875|gb|ADN32880.1|
           photosystem II protein M (chloroplast) [Phyllostachys
           nigra var. henonis] gi|308742591|gb|ADO33442.1|
           photosystem II protein M (plastid) [Smilax china]
           gi|309321514|gb|ADO65054.1| photosystem II protein M
           [Castanea mollissima] gi|309321606|gb|ADO65131.1|
           photosystem II protein M (chloroplast) [Acidosasa
           purpurea] gi|309321690|gb|ADO65214.1| photosystem II
           protein M (plastid) [Ferrocalamus rimosivaginus]
           gi|309321774|gb|ADO65297.1| photosystem II protein M
           (plastid) [Indocalamus longiauritus]
           gi|309321857|gb|ADO65379.1| photosystem II protein M
           (chloroplast) [Phyllostachys edulis]
           gi|309321942|gb|ADO65463.1| photosystem II protein M
           (chloroplast) [Bambusa emeiensis]
           gi|310941543|dbj|BAJ24022.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941545|dbj|BAJ24023.1|
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] gi|310941547|dbj|BAJ24024.1| photosystem II
           protein M (chloroplast) [Lysionotus pauciflorus]
           gi|310941549|dbj|BAJ24025.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941551|dbj|BAJ24026.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941553|dbj|BAJ24027.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941555|dbj|BAJ24028.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941557|dbj|BAJ24029.1|
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] gi|310941559|dbj|BAJ24030.1| photosystem II
           protein M [Lysionotus pauciflorus]
           gi|310941561|dbj|BAJ24031.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941563|dbj|BAJ24032.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941565|dbj|BAJ24033.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941567|dbj|BAJ24034.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941569|dbj|BAJ24035.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941571|dbj|BAJ24036.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941573|dbj|BAJ24037.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941575|dbj|BAJ24038.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941577|dbj|BAJ24039.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941579|dbj|BAJ24040.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941581|dbj|BAJ24041.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941583|dbj|BAJ24042.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941585|dbj|BAJ24043.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941587|dbj|BAJ24044.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941589|dbj|BAJ24045.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941591|dbj|BAJ24046.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941593|dbj|BAJ24047.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941595|dbj|BAJ24048.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941597|dbj|BAJ24049.1|
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] gi|310941599|dbj|BAJ24050.1| photosystem II
           protein M [Lysionotus pauciflorus]
           gi|310941601|dbj|BAJ24051.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310941603|dbj|BAJ24052.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942017|dbj|BAJ24053.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942019|dbj|BAJ24054.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942021|dbj|BAJ24055.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942023|dbj|BAJ24056.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942025|dbj|BAJ24057.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942027|dbj|BAJ24058.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942029|dbj|BAJ24059.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942031|dbj|BAJ24060.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942033|dbj|BAJ24061.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942035|dbj|BAJ24062.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942037|dbj|BAJ24063.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942039|dbj|BAJ24064.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942041|dbj|BAJ24065.1|
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] gi|310942043|dbj|BAJ24066.1| photosystem II
           protein M [Lysionotus pauciflorus]
           gi|310942045|dbj|BAJ24067.1| photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus]
           gi|310942047|dbj|BAJ24068.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942049|dbj|BAJ24069.1|
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] gi|310942051|dbj|BAJ24070.1| photosystem II
           protein M [Lysionotus chingii]
           gi|310942053|dbj|BAJ24071.1| photosystem II protein M
           [Lysionotus chingii] gi|310942055|dbj|BAJ24072.1|
           photosystem II protein M (chloroplast) [Lysionotus
           chingii] gi|310942057|dbj|BAJ24073.1| photosystem II
           protein M [Lysionotus oblongifolius]
           gi|310942059|dbj|BAJ24074.1| photosystem II protein M
           (chloroplast) [Lysionotus oblongifolius]
           gi|310942061|dbj|BAJ24075.1| photosystem II protein M
           (chloroplast) [Lysionotus oblongifolius]
           gi|310942063|dbj|BAJ24076.1| photosystem II protein M
           [Lysionotus denticulosus] gi|310942065|dbj|BAJ24077.1|
           photosystem II protein M [Lysionotus denticulosus]
           gi|310942067|dbj|BAJ24078.1| photosystem II protein M
           [Lysionotus serratus] gi|321575346|gb|ADW94715.1| PsbM
           [Streptocarpus papangae] gi|321575349|gb|ADW94717.1|
           PsbM [Streptocarpus montanus]
           gi|321575352|gb|ADW94719.1| PsbM [Streptocarpus
           fanniniae] gi|321575354|gb|ADW94720.1| PsbM
           [Streptocarpus pusillus] gi|321575357|gb|ADW94722.1|
           PsbM [Streptocarpus dunnii] gi|321575360|gb|ADW94724.1|
           PsbM [Streptocarpus dunnii] gi|321575363|gb|ADW94726.1|
           PsbM [Streptocarpus dunnii] gi|321575366|gb|ADW94728.1|
           PsbM [Streptocarpus dunnii] gi|321575369|gb|ADW94730.1|
           PsbM [Streptocarpus dunnii] gi|321575372|gb|ADW94732.1|
           PsbM [Streptocarpus dunnii] gi|321575375|gb|ADW94734.1|
           PsbM [Streptocarpus dunnii] gi|321575378|gb|ADW94736.1|
           PsbM [Streptocarpus denticulatus]
           gi|321575381|gb|ADW94738.1| PsbM [Streptocarpus
           denticulatus] gi|321575384|gb|ADW94740.1| PsbM
           [Streptocarpus grandis] gi|321575387|gb|ADW94742.1| PsbM
           [Streptocarpus grandis] gi|321575390|gb|ADW94744.1| PsbM
           [Streptocarpus vandeleurii] gi|321575393|gb|ADW94746.1|
           PsbM [Streptocarpus vandeleurii]
           gi|321575396|gb|ADW94748.1| PsbM [Streptocarpus
           rimicola] gi|321575399|gb|ADW94750.1| PsbM
           [Streptocarpus rimicola] gi|321575402|gb|ADW94752.1|
           PsbM [Streptocarpus bolusii] gi|321575405|gb|ADW94754.1|
           PsbM [Streptocarpus bolusii] gi|321575408|gb|ADW94756.1|
           PsbM [Streptocarpus porphyrostachys]
           gi|321575411|gb|ADW94757.1| PsbM [Streptocarpus
           polyanthus] gi|321575416|gb|ADW94759.1| PsbM
           [Streptocarpus saundersii] gi|321575419|gb|ADW94761.1|
           PsbM [Streptocarpus candidus]
           gi|321575422|gb|ADW94763.1| PsbM [Streptocarpus
           gardenii] gi|321575425|gb|ADW94765.1| PsbM
           [Streptocarpus gardenii] gi|321575428|gb|ADW94767.1|
           PsbM [Streptocarpus gardenii]
           gi|321575431|gb|ADW94769.1| PsbM [Streptocarpus
           gardenii] gi|321575434|gb|ADW94771.1| PsbM
           [Streptocarpus gardenii] gi|321575437|gb|ADW94773.1|
           PsbM [Streptocarpus gardenii]
           gi|321575439|gb|ADW94774.1| PsbM [Streptocarpus
           kentaniensis] gi|321575442|gb|ADW94776.1| PsbM
           [Streptocarpus lilliputana] gi|321575445|gb|ADW94778.1|
           PsbM [Streptocarpus lilliputana]
           gi|321575448|gb|ADW94780.1| PsbM [Streptocarpus aylae]
           gi|321575451|gb|ADW94782.1| PsbM [Streptocarpus
           caeruleus] gi|321575454|gb|ADW94784.1| PsbM
           [Streptocarpus caeruleus] gi|321575457|gb|ADW94786.1|
           PsbM [Streptocarpus longiflorus]
           gi|321575460|gb|ADW94788.1| PsbM [Streptocarpus
           parviflorus] gi|321575463|gb|ADW94790.1| PsbM
           [Streptocarpus parviflorus subsp. parviflorus]
           gi|321575466|gb|ADW94792.1| PsbM [Streptocarpus cyaneus
           subsp. nigridens] gi|321575469|gb|ADW94794.1| PsbM
           [Streptocarpus cyaneus] gi|321575472|gb|ADW94796.1| PsbM
           [Streptocarpus cyaneus] gi|321575475|gb|ADW94798.1| PsbM
           [Streptocarpus floribundus] gi|321575477|gb|ADW94799.1|
           PsbM [Streptocarpus meyeri] gi|321575480|gb|ADW94801.1|
           PsbM [Streptocarpus meyeri] gi|321575483|gb|ADW94803.1|
           PsbM [Streptocarpus meyeri] gi|321575486|gb|ADW94805.1|
           PsbM [Streptocarpus meyeri] gi|321575489|gb|ADW94807.1|
           PsbM [Streptocarpus meyeri] gi|321575492|gb|ADW94809.1|
           PsbM [Streptocarpus meyeri] gi|321575496|gb|ADW94810.1|
           PsbM [Streptocarpus meyeri] gi|321575498|gb|ADW94811.1|
           PsbM [Streptocarpus meyeri] gi|321575502|gb|ADW94813.1|
           PsbM [Streptocarpus meyeri] gi|321575505|gb|ADW94815.1|
           PsbM [Streptocarpus meyeri] gi|321575508|gb|ADW94817.1|
           PsbM [Streptocarpus meyeri] gi|321575511|gb|ADW94819.1|
           PsbM [Streptocarpus meyeri] gi|321575514|gb|ADW94821.1|
           PsbM [Streptocarpus meyeri] gi|321575516|gb|ADW94822.1|
           PsbM [Streptocarpus meyeri] gi|321575518|gb|ADW94823.1|
           PsbM [Streptocarpus meyeri] gi|321575535|gb|ADW94832.1|
           PsbM [Streptocarpus baudertii]
           gi|321575538|gb|ADW94834.1| PsbM [Streptocarpus
           johannis] gi|321575541|gb|ADW94836.1| PsbM
           [Streptocarpus johannis] gi|321575545|gb|ADW94837.1|
           PsbM [Streptocarpus johannis]
           gi|321575548|gb|ADW94838.1| PsbM [Streptocarpus
           johannis] gi|321575551|gb|ADW94840.1| PsbM
           [Streptocarpus modestus] gi|321575554|gb|ADW94842.1|
           PsbM [Streptocarpus modestus]
           gi|321575558|gb|ADW94844.1| PsbM [Streptocarpus
           formosus] gi|321575561|gb|ADW94846.1| PsbM
           [Streptocarpus formosus] gi|321575564|gb|ADW94848.1|
           PsbM [Streptocarpus formosus]
           gi|321575567|gb|ADW94850.1| PsbM [Streptocarpus
           formosus] gi|321575570|gb|ADW94852.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575573|gb|ADW94854.1| PsbM [Streptocarpus
           primulifolius] gi|321575576|gb|ADW94856.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575579|gb|ADW94858.1| PsbM [Streptocarpus
           primulifolius] gi|321575582|gb|ADW94860.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575585|gb|ADW94862.1| PsbM [Streptocarpus
           primulifolius] gi|321575588|gb|ADW94864.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575590|gb|ADW94865.1| PsbM [Streptocarpus
           primulifolius] gi|321575595|gb|ADW94866.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575601|gb|ADW94867.1| PsbM [Streptocarpus
           primulifolius] gi|321575603|gb|ADW94868.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575608|gb|ADW94869.1| PsbM [Streptocarpus rexii]
           gi|321575610|gb|ADW94870.1| PsbM [Streptocarpus rexii]
           gi|321575614|gb|ADW94871.1| PsbM [Streptocarpus rexii]
           gi|321575618|gb|ADW94872.1| PsbM [Streptocarpus rexii]
           gi|325305702|gb|ADZ10863.1| photosystem II protein M
           (chloroplast) [Elaeis guineensis]
           gi|328795427|emb|CBR30309.1| photosystem II protein M
           [Olea europaea subsp. europaea]
           gi|329124576|gb|AEB72133.1| photosystem II protein M
           (chloroplast) [Solanum tuberosum]
           gi|329124663|gb|AEB72219.1| photosystem II protein M
           (chloroplast) [Solanum tuberosum]
           gi|329668847|gb|AEB96294.1| photosystem II protein M
           (chloroplast) [Phalaenopsis equestris]
           gi|329755433|gb|AEC03997.1| photosystem II protein M
           (chloroplast) [Silene conica]
           gi|329755515|gb|AEC04078.1| photosystem II protein M
           (chloroplast) [Silene latifolia]
           gi|329755597|gb|AEC04159.1| photosystem II protein M
           (chloroplast) [Silene noctiflora]
           gi|329755680|gb|AEC04241.1| photosystem II protein M
           (chloroplast) [Silene vulgaris]
           gi|334084395|emb|CBR23823.1| photosystem II protein M
           [Olea europaea subsp. cuspidata]
           gi|334084481|emb|CBR24614.1| photosystem II protein M
           [Olea europaea subsp. europaea]
           gi|334084567|emb|CBR30400.1| photosystem II protein M
           [Olea europaea subsp. europaea]
           gi|334084653|emb|CBS29344.1| photosystem II protein M
           [Olea woodiana subsp. woodiana]
           gi|334084858|emb|CBS29231.1| photosystem II protein M
           [Olea europaea subsp. maroccana]
           gi|334084944|emb|CBJ04292.1| photosystem II protein M
           [Olea europaea subsp. cuspidata]
           gi|334085030|emb|CBR23732.1| photosystem II protein M
           [Olea europaea subsp. cuspidata]
           gi|334089659|gb|AEG64542.1| photosystem II protein M
           (chloroplast) [Ageratina adenophora]
           gi|336326827|gb|AEI53005.1| photosystem II protein M
           (chloroplast) [Oryza meridionalis]
           gi|336326903|gb|AEI53080.1| photosystem II protein M
           (chloroplast) [Oryza rufipogon]
           gi|336326981|gb|AEI53157.1| photosystem II protein M
           (chloroplast) [Oryza rufipogon]
           gi|337730900|gb|AEI70794.1| photosystem II protein M
           (chloroplast) [Puelia olyriformis]
           gi|340536633|gb|AEK48400.1| photosystem II protein M
           (chloroplast) [Colocasia esculenta]
           gi|340536720|gb|AEK48486.1| photosystem II protein M
           (chloroplast) [Colocasia esculenta]
           gi|340549401|gb|AEK53223.1| photosystem II protein M
           (chloroplast) [Boea hygrometrica]
           gi|341834065|gb|AEK94336.1| photosystem II protein M
           (chloroplast) [Spirodela polyrhiza]
           gi|341834149|gb|AEK94419.1| photosystem II protein M
           [Wolffiella lingulata] gi|341834233|gb|AEK94502.1|
           photosystem II protein M [Wolffia australiana]
           gi|343887533|gb|AEM65212.1| PsbM [Magnolia denudata]
           gi|346228292|gb|AEO21166.1| photosystem II protein M
           (plastid) [Leersia tisserantii]
           gi|346228376|gb|AEO21249.1| photosystem II protein M
           (chloroplast) [Phyllostachys propinqua]
           gi|346228460|gb|AEO21332.1| photosystem II protein M
           (plastid) [Rhynchoryza subulata]
           gi|347448289|gb|AEO92700.1| PSII M protein (chloroplast)
           [Sesamum indicum] gi|347453896|gb|AEO95554.1|
           photosystem II protein M (chloroplast) [Nicotiana
           undulata] gi|347454007|gb|AEO95664.1| photosystem II
           protein M [synthetic construct]
           gi|350996420|gb|AEQ36932.1| photosystem II M protein
           (chloroplast) [Datura stramonium]
           gi|350996507|gb|AEQ37018.1| photosystem II M protein
           [Datura stramonium] gi|353685043|gb|AER12808.1|
           photosystem II protein M (chloroplast) [Oryza sativa
           Indica Group] gi|353685209|gb|AER12973.1| photosystem II
           protein M (chloroplast) [Oryza sativa Indica Group]
           gi|353742605|dbj|BAL04669.1| photosystem II reaction
           center protein M [Isodon shikokianus var. occidentalis]
           gi|353742608|dbj|BAL04671.1| photosystem II reaction
           center protein M [Isodon shikokianus var. intermedius]
           gi|353742611|dbj|BAL04673.1| photosystem II reaction
           center protein M [Isodon japonicus]
           gi|353742614|dbj|BAL04675.1| photosystem II reaction
           center protein M [Isodon trichocarpus]
           gi|353742617|dbj|BAL04677.1| photosystem II reaction
           center protein M [Isodon effusus]
           gi|353742620|dbj|BAL04679.1| photosystem II reaction
           center protein M [Isodon shikokianus var. intermedius]
           gi|353742623|dbj|BAL04681.1| photosystem II reaction
           center protein M [Isodon effusus]
           gi|353742626|dbj|BAL04683.1| photosystem II reaction
           center protein M (chloroplast) [Isodon umbrosus]
           gi|353742629|dbj|BAL04685.1| photosystem II reaction
           center protein M [Isodon trichocarpus]
           gi|353742632|dbj|BAL04687.1| photosystem II reaction
           center protein M [Isodon inflexus]
           gi|353742635|dbj|BAL04689.1| photosystem II reaction
           center protein M [Isodon inflexus]
           gi|353742638|dbj|BAL04691.1| photosystem II reaction
           center protein M [Isodon shikokianus var. occidentalis]
           gi|353742641|dbj|BAL04693.1| photosystem II reaction
           center protein M [Isodon longitubus]
           gi|353742644|dbj|BAL04695.1| photosystem II reaction
           center protein M [Isodon japonicus]
           gi|353742647|dbj|BAL04697.1| photosystem II reaction
           center protein M [Isodon excisus]
           gi|353742650|dbj|BAL04699.1| photosystem II reaction
           center protein M (chloroplast) [Isodon longitubus]
           gi|371572064|gb|AEX37335.1| photosystem II protein M
           (chloroplast) [Arbutus unedo]
           gi|372000623|gb|AEX65388.1| photosystem II protein M
           [Blossfeldia liliputana] gi|372000625|gb|AEX65389.1|
           photosystem II protein M [Didierea madagascariensis]
           gi|372000629|gb|AEX65391.1| photosystem II protein M
           [Mollugo verticillata] gi|372000635|gb|AEX65394.1|
           photosystem II protein M [Pereskiopsis diguetii]
           gi|372862245|gb|AEX98328.1| photosystem II M protein
           (chloroplast) [Magnolia denudata]
           gi|372862415|gb|AEX98496.1| photosystem II M protein
           (chloroplast) [Magnolia officinalis]
           gi|372862498|gb|AEX98578.1| photosystem II M protein
           (chloroplast) [Magnolia officinalis subsp. biloba]
           gi|372862583|gb|AEX98662.1| photosystem II M protein
           (chloroplast) [Magnolia officinalis subsp. biloba]
           gi|372862668|gb|AEX98746.1| photosystem II M protein
           (chloroplast) [Magnolia officinalis subsp. biloba]
           gi|372862837|gb|AEX98913.1| photosystem II M protein
           (chloroplast) [Magnolia grandiflora]
           gi|372863007|gb|AEX99081.1| photosystem II M protein
           (chloroplast) [Magnolia grandiflora]
           gi|374094590|gb|AEY84646.1| photosystem II protein M
           (chloroplast) [Elodea canadensis]
           gi|374257013|gb|AEZ01421.1| photosystem II protein M
           (chloroplast) [Japonolirion osense]
           gi|374962496|gb|AFA26836.1| photosystem II protein M
           (plastid) [Albuca kirkii] gi|374962502|gb|AFA26839.1|
           photosystem II protein M, partial (plastid)
           [Belosynapsis ciliata] gi|374962504|gb|AFA26840.1|
           photosystem II protein M, partial (plastid) [Brocchinia
           micrantha] gi|374962506|gb|AFA26841.1| photosystem II
           protein M (plastid) [Centrolepis monogyna]
           gi|374962508|gb|AFA26842.1| photosystem II protein M,
           partial (plastid) [Chamaedorea seifrizii]
           gi|374962514|gb|AFA26845.1| photosystem II protein M
           (plastid) [Dasypogon bromeliifolius]
           gi|374962522|gb|AFA26849.1| photosystem II protein M,
           partial (plastid) [Fosterella caulescens]
           gi|374962534|gb|AFA26855.1| photosystem II protein M
           (plastid) [Juncus effusus] gi|374962536|gb|AFA26856.1|
           photosystem II protein M, partial (plastid) [Kingia
           australis] gi|374962542|gb|AFA26859.1| photosystem II
           protein M, partial (plastid) [Navia saxicola]
           gi|374962546|gb|AFA26861.1| photosystem II protein M,
           partial (plastid) [Neoregelia carolinae]
           gi|374962554|gb|AFA26865.1| photosystem II protein M,
           partial (plastid) [Pitcairnia feliciana]
           gi|374962556|gb|AFA26866.1| photosystem II protein M,
           partial (plastid) [Potarophytum riparium]
           gi|374962558|gb|AFA26867.1| photosystem II protein M,
           partial (plastid) [Puya laxa]
           gi|374962560|gb|AFA26868.1| photosystem II protein M,
           partial (plastid) [Ravenea hildebrandtii]
           gi|374962562|gb|AFA26869.1| photosystem II protein M,
           partial (plastid) [Renealmia alpinia]
           gi|374962564|gb|AFA26870.1| photosystem II protein M,
           partial (plastid) [Sparganium eurycarpum]
           gi|374962566|gb|AFA26871.1| photosystem II protein M
           (plastid) [Syngonanthus chrysanthus]
           gi|374962568|gb|AFA26872.1| photosystem II protein M
           (plastid) [Thamnochortus insignis]
           gi|374962572|gb|AFA26874.1| photosystem II protein M,
           partial (plastid) [Tradescantia ohiensis]
           gi|383286791|gb|AFH01441.1| photosystem II protein M
           (chloroplast) [Nelumbo nucifera]
           gi|383286886|gb|AFH01535.1| photosystem II protein M
           (chloroplast) [Nelumbo lutea]
           gi|388893201|gb|AFK81293.1| photosystem II protein M
           [Camellia sinensis var. assamica]
           gi|388893289|gb|AFK81380.1| photosystem II protein M
           [Camellia oleifera] gi|388893377|gb|AFK81467.1|
           photosystem II protein M [Camellia taliensis]
           gi|392841332|gb|AFM83287.1| photosystem II protein M
           (chloroplast) [Kingia australis]
           gi|392934147|gb|AFM92273.1| photosystem II protein M
           (chloroplast) [Pachycladon cheesemanii]
           gi|401065926|gb|AFP90770.1| photosystem II protein M
           (chloroplast) [Capsicum annuum]
           gi|401879736|gb|AFQ30923.1| photosystem II M protein
           (chloroplast) [Salvia miltiorrhiza]
           gi|403226775|gb|AFR25654.1| photosystem II protein M
           (chloroplast) [Penthorum chinense]
           gi|407030070|gb|AFS67053.1| photosystem II protein M
           (chloroplast) [Arundinaria fargesii]
           gi|407030154|gb|AFS67136.1| photosystem II protein M
           (chloroplast) [Sarocalamus faberi]
           gi|407030239|gb|AFS67220.1| photosystem II protein M
           (chloroplast) [Chimonocalamus longiusculus]
           gi|407030322|gb|AFS67302.1| photosystem II protein M
           (chloroplast) [Fargesia nitida]
           gi|407030406|gb|AFS67385.1| photosystem II protein M
           (chloroplast) [Fargesia spathacea]
           gi|407030490|gb|AFS67468.1| photosystem II protein M
           (chloroplast) [Fargesia yunnanensis]
           gi|407030574|gb|AFS67551.1| photosystem II protein M
           (chloroplast) [Gaoligongshania megalothyrsa]
           gi|407030658|gb|AFS67634.1| photosystem II protein M
           (chloroplast) [Gelidocalamus tessellatus]
           gi|407030742|gb|AFS67717.1| photosystem II protein M
           (chloroplast) [Indocalamus wilsonii]
           gi|407030826|gb|AFS67800.1| photosystem II protein M
           (chloroplast) [Indosasa sinica]
           gi|407030909|gb|AFS67882.1| photosystem II protein M
           (chloroplast) [Oligostachyum shiuyingianum]
           gi|407030992|gb|AFS67964.1| photosystem II protein M
           (chloroplast) [Pleioblastus maculatus]
           gi|407031075|gb|AFS68046.1| photosystem II protein M
           (chloroplast) [Thamnocalamus spathiflorus]
           gi|407031159|gb|AFS68129.1| photosystem II protein M
           (chloroplast) [Yushania levigata]
           gi|408898183|gb|AFU93998.1| PsbM, partial (chloroplast)
           [Medusagyne oppositifolia] gi|408898199|gb|AFU94006.1|
           PsbM, partial (chloroplast) [Rhizophora mangle]
           gi|410176149|gb|AFV61808.1| PSII M protein (chloroplast)
           [Origanum vulgare subsp. vulgare]
           gi|427920150|gb|AFY64181.1| photosystem II protein M
           (chloroplast) [Najas flexilis]
           gi|430728266|gb|AGA55590.1| PSII M protein (chloroplast)
           [Camellia sinensis] gi|438687598|emb|CCP47124.1|
           photosystem II protein M (chloroplast) [Tectona grandis]
           gi|438688282|emb|CCP47213.1| photosystem II protein M
           (chloroplast) [Tectona grandis]
           gi|438688406|emb|CCP47302.1| photosystem II protein M
           (chloroplast) [Tectona grandis]
           gi|441421916|gb|AGC31240.1| photosystem II protein M
           [Quercus rubra] gi|441480239|gb|AGC38151.1| photosystem
           II protein M (chloroplast) [Arundinaria gigantea]
           gi|449020247|gb|AGE65744.1| photosystem II protein M
           (chloroplast) [Pharus lappulaceus]
           gi|449326092|gb|AGE92678.1| photosystem II protein M
           [Heliconia collinsiana] gi|449326178|gb|AGE92763.1|
           photosystem II protein M [Zingiber spectabile]
           gi|449326264|gb|AGE92848.1| photosystem II protein M
           [Pseudophoenix vinifera] gi|449326351|gb|AGE92934.1|
           photosystem II protein M [Calamus caryotoides]
           gi|449326438|gb|AGE93020.1| photosystem II protein M
           [Bismarckia nobilis] gi|449326525|gb|AGE93106.1|
           photosystem II protein M [Dasypogon bromeliifolius]
           gi|449326699|gb|AGE93278.1| photosystem II protein M
           [Chamaedorea seifrizii] gi|449326786|gb|AGE93364.1|
           photosystem II protein M [Alpinia zerumbet]
           gi|449326873|gb|AGE93450.1| photosystem II protein M
           [Xiphidium caeruleum] gi|449713835|emb|CCJ32511.1| PsbM
           (chloroplast) [Trithuria inconspicua]
           gi|469473991|gb|AGH33761.1| photosystem II protein M
           (chloroplast) [Puelia olyriformis]
           gi|474452070|gb|AGI51138.1| photosystem II protein M
           (chloroplast) [Catharanthus roseus]
           gi|478733639|gb|AGJ51250.1| photosystem II protein M
           (chloroplast) [Solanum carolinense]
           gi|479279197|gb|AGJ72051.1| photosystem II protein M
           (chloroplast) [Tetracentron sinense]
           gi|479279290|gb|AGJ72143.1| photosystem II protein M
           (chloroplast) [Trochodendron aralioides]
           gi|496538595|gb|AGL45330.1| PsbM (chloroplast) [Sesamum
           indicum] gi|498921848|gb|AGL61069.1| photosystem II
           protein M (chloroplast) [Utricularia gibba]
           gi|500186929|gb|AGL81771.1| photosystem II protein M
           [Streptocarpus cooksonii] gi|500186932|gb|AGL81773.1|
           photosystem II protein M [Streptocarpus daviesii]
           gi|500186935|gb|AGL81775.1| photosystem II protein M
           [Streptocarpus daviesii] gi|500186938|gb|AGL81777.1|
           photosystem II protein M [Streptocarpus grandis]
           gi|500186941|gb|AGL81779.1| photosystem II protein M
           [Streptocarpus grandis] gi|500186944|gb|AGL81781.1|
           photosystem II protein M [Streptocarpus grandis]
           gi|500186947|gb|AGL81783.1| photosystem II protein M
           [Streptocarpus grandis] gi|500186950|gb|AGL81785.1|
           photosystem II protein M [Streptocarpus hilsenbergii]
           gi|500186953|gb|AGL81787.1| photosystem II protein M
           [Streptocarpus huamboensis] gi|500186956|gb|AGL81789.1|
           photosystem II protein M [Streptocarpus makabengensis]
           gi|500186959|gb|AGL81791.1| photosystem II protein M
           [Streptocarpus sp. MdV-2012] gi|500186962|gb|AGL81793.1|
           photosystem II protein M [Streptocarpus sp. MdV-2012]
           gi|500186965|gb|AGL81795.1| photosystem II protein M
           [Streptocarpus molweniensis] gi|500186968|gb|AGL81797.1|
           photosystem II protein M [Streptocarpus monophyllus]
           gi|500186971|gb|AGL81799.1| photosystem II protein M
           [Streptocarpus occultus] gi|500186974|gb|AGL81801.1|
           photosystem II protein M [Streptocarpus saundersii]
           gi|500186977|gb|AGL81803.1| photosystem II protein M
           [Streptocarpus wendlandii] gi|500186980|gb|AGL81805.1|
           photosystem II protein M [Streptocarpus wilmsii]
           gi|500186983|gb|AGL81807.1| photosystem II protein M
           [Streptocarpus monophyllus] gi|510934398|emb|CCQ09096.1|
           photosystem II protein M (chloroplast) [Olea europaea
           subsp. europaea] gi|511262214|gb|AGN72208.1| photosystem
           II protein M (chloroplast) [Arundinaria appalachiana]
           gi|511262298|gb|AGN72291.1| photosystem II protein M
           (chloroplast) [Arundinaria tecta]
           gi|511369817|gb|AGN73974.1| photosystem II M protein
           (chloroplast) [Aconitum barbatum var. puberulum]
           gi|519666906|gb|AGO98518.1| photosystem II protein M
           (chloroplast) [Nelumbo nucifera]
           gi|523706685|gb|AGQ55669.1| photosystem II protein M
           (chloroplast) [Alstroemeria aurea]
           gi|525312451|emb|CCW72369.1| psbM (chloroplast) [Musa
           acuminata subsp. malaccensis]
           gi|528748770|gb|AGS43460.1| photosystem II protein M
           (chloroplast) [Cocos nucifera]
           gi|532164830|gb|AGT79840.1| PSII M protein (chloroplast)
           [Andrographis paniculata] gi|537362485|gb|AGU44293.1|
           photosystem II protein M (chloroplast) [Camellia
           cuspidata] gi|537362571|gb|AGU44378.1| photosystem II
           protein M (chloroplast) [Camellia danzaiensis]
           gi|537362663|gb|AGU44469.1| photosystem II protein M
           (chloroplast) [Camellia impressinervis]
           gi|537362753|gb|AGU44558.1| photosystem II protein M
           (chloroplast) [Camellia taliensis]
           gi|537362843|gb|AGU44647.1| photosystem II protein M
           (chloroplast) [Camellia pitardii]
           gi|537362933|gb|AGU44736.1| photosystem II protein M
           (chloroplast) [Camellia yunnanensis]
           gi|537363023|gb|AGU44825.1| photosystem II protein M
           (chloroplast) [Camellia taliensis]
           gi|537366279|gb|AGU46460.1| photosystem II protein M
           (plastid) [Hyoscyamus niger] gi|546352424|gb|AGW96331.1|
           photosystem II protein M (chloroplast) [Ipomoea batatas]
           gi|546352510|gb|AGW96416.1| photosystem II protein M
           (chloroplast) [Ipomoea batatas]
           gi|546352596|gb|AGW96501.1| photosystem II protein M
           (chloroplast) [Ipomoea batatas]
           gi|546352682|gb|AGW96586.1| photosystem II protein M
           (chloroplast) [Ipomoea trifida]
           gi|546352767|gb|AGW96670.1| photosystem II protein M
           (chloroplast) [Argyreia nervosa]
           gi|546352853|gb|AGW96755.1| photosystem II protein M
           (chloroplast) [Ipomoea amnicola]
           gi|546352939|gb|AGW96840.1| photosystem II protein M
           (chloroplast) [Ipomoea argillicola]
           gi|546353025|gb|AGW96925.1| photosystem II protein M
           (chloroplast) [Ipomoea cairica]
           gi|546353111|gb|AGW97010.1| photosystem II protein M
           (chloroplast) [Ipomoea diamantinensis]
           gi|546353283|gb|AGW97180.1| photosystem II protein M
           (chloroplast) [Ipomoea eriocarpa]
           gi|546353369|gb|AGW97265.1| photosystem II protein M
           (chloroplast) [Ipomoea hederifolia]
           gi|546353455|gb|AGW97350.1| photosystem II protein M
           (chloroplast) [Ipomoea involucrata]
           gi|546353541|gb|AGW97435.1| photosystem II protein M
           (chloroplast) [Ipomoea murucoides]
           gi|546353627|gb|AGW97520.1| photosystem II protein M
           (chloroplast) [Ipomoea nil] gi|546353713|gb|AGW97605.1|
           photosystem II protein M (chloroplast) [Ipomoea
           orizabensis] gi|546353799|gb|AGW97690.1| photosystem II
           protein M (chloroplast) [Ipomoea pedicellaris]
           gi|546353885|gb|AGW97775.1| photosystem II protein M
           (chloroplast) [Ipomoea pes-caprae]
           gi|546353971|gb|AGW97860.1| photosystem II protein M
           (chloroplast) [Ipomoea polpha]
           gi|546354057|gb|AGW97945.1| photosystem II protein M
           (chloroplast) [Ipomoea setosa]
           gi|546354142|gb|AGW98029.1| photosystem II protein M
           (chloroplast) [Ipomoea splendor-sylvae]
           gi|546354228|gb|AGW98114.1| photosystem II protein M
           (chloroplast) [Ipomoea ternifolia]
           gi|546354314|gb|AGW98199.1| photosystem II protein M
           (chloroplast) [Ipomoea tricolor]
           gi|546354400|gb|AGW98284.1| photosystem II protein M
           (chloroplast) [Ipomoea trifida]
           gi|546354486|gb|AGW98369.1| photosystem II protein M
           (chloroplast) [Ipomoea cordatotriloba]
           gi|546354572|gb|AGW98454.1| photosystem II protein M
           (chloroplast) [Ipomoea minutiflora]
           gi|546354658|gb|AGW98539.1| photosystem II protein M
           (chloroplast) [Ipomoea obscura]
           gi|546354744|gb|AGW98624.1| photosystem II protein M
           (chloroplast) [Ipomoea pes-tigridis]
           gi|546354830|gb|AGW98709.1| photosystem II protein M
           (chloroplast) [Merremia quinquefolia]
           gi|546354916|gb|AGW98794.1| photosystem II protein M
           (chloroplast) [Operculina macrocarpa]
           gi|546355002|gb|AGW98879.1| photosystem II protein M
           (chloroplast) [Stictocardia macalusoi]
           gi|546355088|gb|AGW98964.1| photosystem II protein M
           (chloroplast) [Turbina corymbosa]
           gi|549533508|gb|AGX29600.1| photosystem II protein M
           (chloroplast) [Aster spathulifolius]
           gi|555298128|gb|AGZ13228.1| photosystem II protein M
           (plastid) [Olyra latifolia] gi|555944096|gb|AGZ17999.1|
           photosystem II protein M (chloroplast) [Silene conoidea]
           gi|555944178|gb|AGZ18080.1| photosystem II protein M
           (chloroplast) [Silene chalcedonica]
           gi|555944259|gb|AGZ18160.1| photosystem II protein M
           (chloroplast) [Silene paradoxa]
           gi|555945910|gb|AGZ19137.1| photosystem II protein M
           (chloroplast) [Camellia sinensis]
           gi|555945976|gb|AGZ19202.1| photosystem II protein M
           (chloroplast) [Oryza rufipogon]
           gi|557136857|emb|CDI43912.1| photosystem II protein M
           (chloroplast) [Lindenbergia philippensis]
           gi|557636906|gb|AHA12508.1| photosystem II protein M
           [Musa textilis] gi|557636993|gb|AHA12594.1| photosystem
           II protein M [Ravenala madagascariensis]
           gi|557637077|gb|AHA12677.1| photosystem II protein M
           [Orchidantha fimbriata] gi|557637150|gb|AHA12749.1|
           photosystem II protein M [Canna indica]
           gi|557637235|gb|AHA12833.1| photosystem II protein M
           [Maranta leuconeura] gi|557637321|gb|AHA12918.1|
           photosystem II protein M [Monocostus uniflorus]
           gi|557637408|gb|AHA13004.1| photosystem II protein M
           [Costus pulverulentus] gi|557637495|gb|AHA13090.1|
           photosystem II protein M [Curcuma roscoeana]
           gi|557637582|gb|AHA13176.1| photosystem II protein M
           [Thaumatococcus daniellii] gi|558697168|gb|AHA84923.1|
           photosystem II protein M [Ajuga reptans]
           gi|559768001|gb|AHB14443.1| photosystem II protein M
           [Helianthus giganteus] gi|559768087|gb|AHB14528.1|
           photosystem II protein M [Helianthus giganteus]
           gi|559768173|gb|AHB14613.1| photosystem II protein M
           [Helianthus giganteus] gi|559768259|gb|AHB14698.1|
           photosystem II protein M [Helianthus giganteus]
           gi|559768345|gb|AHB14783.1| photosystem II protein M
           [Helianthus grosseserratus] gi|559768431|gb|AHB14868.1|
           photosystem II protein M [Helianthus grosseserratus]
           gi|559768517|gb|AHB14953.1| photosystem II protein M
           [Helianthus divaricatus] gi|559768603|gb|AHB15038.1|
           photosystem II protein M [Helianthus divaricatus]
           gi|559768689|gb|AHB15123.1| photosystem II protein M
           [Helianthus divaricatus] gi|559768775|gb|AHB15208.1|
           photosystem II protein M [Helianthus divaricatus]
           gi|559768861|gb|AHB15293.1| photosystem II protein M
           [Helianthus decapetalus] gi|559768947|gb|AHB15378.1|
           photosystem II protein M [Helianthus decapetalus]
           gi|559769033|gb|AHB15463.1| photosystem II protein M
           [Helianthus decapetalus] gi|559769119|gb|AHB15548.1|
           photosystem II protein M [Helianthus hirsutus]
           gi|559769205|gb|AHB15633.1| photosystem II protein M
           [Helianthus hirsutus] gi|559769291|gb|AHB15718.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|559769377|gb|AHB15803.1| photosystem II protein M
           [Helianthus tuberosus] gi|559769463|gb|AHB15888.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|559769549|gb|AHB15973.1| photosystem II protein M
           [Helianthus divaricatus] gi|559769635|gb|AHB16058.1|
           photosystem II protein M [Helianthus giganteus]
           gi|559769721|gb|AHB16143.1| photosystem II protein M
           [Helianthus giganteus] gi|559769807|gb|AHB16228.1|
           photosystem II protein M [Helianthus grosseserratus]
           gi|559769893|gb|AHB16313.1| photosystem II protein M
           [Helianthus grosseserratus] gi|559769979|gb|AHB16398.1|
           photosystem II protein M [Helianthus grosseserratus]
           gi|559770065|gb|AHB16483.1| photosystem II protein M
           [Helianthus grosseserratus] gi|559770151|gb|AHB16568.1|
           photosystem II protein M [Helianthus decapetalus]
           gi|559770237|gb|AHB16653.1| photosystem II protein M
           [Helianthus decapetalus] gi|559770323|gb|AHB16738.1|
           photosystem II protein M [Helianthus decapetalus]
           gi|559770409|gb|AHB16823.1| photosystem II protein M
           [Helianthus hirsutus] gi|559770495|gb|AHB16908.1|
           photosystem II protein M [Helianthus hirsutus]
           gi|559770581|gb|AHB16993.1| photosystem II protein M
           [Helianthus strumosus] gi|559770667|gb|AHB17078.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|559770753|gb|AHB17163.1| photosystem II protein M
           [Helianthus tuberosus] gi|559770839|gb|AHB17248.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|559770925|gb|AHB17333.1| photosystem II protein M
           [Helianthus maximiliani] gi|559771011|gb|AHB17418.1|
           photosystem II protein M [Helianthus maximiliani]
           gi|559771097|gb|AHB17503.1| photosystem II protein M
           [Helianthus maximiliani] gi|559771183|gb|AHB17588.1|
           photosystem II protein M [Helianthus maximiliani]
           gi|560176694|emb|CDJ38613.1| photosystem II protein M
           (chloroplast) [Schwalbea americana]
           gi|563322717|gb|AHB38648.1| photosystem II protein M
           (chloroplast) [Trithuria filamentosa]
           gi|573015050|gb|AHF71634.1| photosystem II protein M
           (chloroplast) [Camellia crapnelliana]
           gi|573015139|gb|AHF71722.1| photosystem II protein M
           (chloroplast) [Nymphaea mexicana]
           gi|573015588|gb|AHF72166.1| photosystem II protein M
           (chloroplast) [Magnolia yunnanensis]
           gi|573461945|emb|CCQ71614.1| photosystem II protein M
           (chloroplast) [Salvia miltiorrhiza]
           gi|575882134|emb|CDL78808.1| photosystem II protein M
           (chloroplast) [Pinguicula ehlersiae]
           gi|576090117|gb|AHH24327.1| photosystem II protein M
           (chloroplast) [Japonolirion osense]
           gi|576598273|gb|AHH30435.1| photosystem II protein M
           (chloroplast) [Bartsia inaequalis]
           gi|582980416|gb|AHI45608.1| photosystem II protein M
           [Sabal domingensis] gi|584297175|gb|AHI87521.1|
           photosystem II protein M (chloroplast) [Chionographis
           japonica] gi|589387945|gb|AHL16901.1| photosystem II
           protein M (chloroplast) [Castanopsis echinocarpa]
           gi|594543308|gb|AHM02389.1| photosystem II protein M
           (chloroplast) [Praxelis clematidea]
           gi|597441138|gb|AHN07164.1| photosystem II protein M
           [Cardamine impatiens] gi|597441224|gb|AHN07249.1|
           photosystem II protein M [Cardamine resedifolia]
           gi|597710358|gb|AHN16119.1| photosystem II protein M
           (chloroplast) [Trigonobalanus doichangensis]
           gi|608608398|gb|AHW51952.1| photosystem II protein M
           (plastid) [Magnolia tripetala]
           gi|608608775|gb|AHW52178.1| photosystem II protein M
           (chloroplast) [Rhazya stricta]
           gi|629514438|gb|AHY86169.1| photosystem II protein M
           (plastid) [Ampelocalamus calcareus]
           gi|631793225|gb|AHZ18125.1| photosystem II protein M
           [Dioscorea rotundata] gi|632812735|gb|AHZ42965.1|
           photosystem II protein M (chloroplast) [Cypripedium
           formosanum] gi|634743448|gb|AHZ60699.1| photosystem II
           protein M [Oryza glaberrima] gi|634744444|gb|AHZ61367.1|
           photosystem II protein M (plastid) [Bergbambos
           tessellata] gi|638920126|gb|AIA24166.1| photosystem II
           protein M (plastid) [Indocalamus sinicus]
           gi|638920195|gb|AIA24211.1| photosystem II protein M
           (plastid) [Oldeania alpina] gi|641803805|gb|AIA76956.1|
           photosystem II protein M (chloroplast) (chloroplast)
           [Capsicum annuum var. glabriusculum]
           gi|645929203|gb|AIB08727.1| photosystem II protein M
           (plastid) [Rhazya stricta] gi|648933330|gb|AIC37268.1|
           photosystem II protein M [Cypripedium japonicum]
           gi|662117277|gb|AIE44563.1| photosystem II protein M
           (chloroplast) [Oryza australiensis]
           gi|667670069|gb|AIG61247.1| photosystem II protein M
           (chloroplast) [Camellia grandibracteata]
           gi|667670157|gb|AIG61334.1| photosystem II protein M
           (chloroplast) [Camellia leptophylla]
           gi|667670245|gb|AIG61421.1| photosystem II protein M
           (chloroplast) [Camellia petelotii]
           gi|667670333|gb|AIG61508.1| photosystem II protein M
           (chloroplast) [Camellia pubicosta]
           gi|667670421|gb|AIG61595.1| photosystem II protein M
           (chloroplast) [Camellia reticulata]
           gi|667670510|gb|AIG61683.1| photosystem II protein M
           (chloroplast) [Camellia sinensis var. dehungensis]
           gi|667670598|gb|AIG61770.1| photosystem II protein M
           (chloroplast) [Camellia sinensis var. pubilimba]
           gi|667670686|gb|AIG61857.1| photosystem II protein M
           (chloroplast) [Camellia sinensis var. sinensis]
           gi|668349605|gb|AIH00226.1| photosystem II protein M
           (chloroplast) [Bambusa multiplex]
           gi|668349691|gb|AIH00311.1| photosystem II protein M
           (chloroplast) [Phyllostachys sulphurea]
           gi|684183666|gb|AIM52856.1| photosystem II protein M
           (plastid) [Bambusa bambos] gi|684183750|gb|AIM52940.1|
           photosystem II protein M (plastid) [Bambusa arnhemica]
           gi|684183834|gb|AIM53024.1| photosystem II protein M
           (plastid) [Chusquea spectabilis]
           gi|684183918|gb|AIM53108.1| photosystem II protein M
           (plastid) [Diandrolyra sp. Clark 1301]
           gi|684183999|gb|AIM53188.1| photosystem II protein M
           (plastid) [Eremitis sp. Clark & Zhang 1343]
           gi|684184080|gb|AIM53268.1| photosystem II protein M
           (plastid) [Greslania sp. McPherson 19217]
           gi|684184164|gb|AIM53352.1| photosystem II protein M
           (plastid) [Hickelia madagascariensis]
           gi|684184248|gb|AIM53436.1| photosystem II protein M
           (plastid) [Neohouzeaua sp. Clark & Attigala 1712]
           gi|684184332|gb|AIM53520.1| photosystem II protein M
           (plastid) [Neololeba atra] gi|684184416|gb|AIM53604.1|
           photosystem II protein M (plastid) [Olmeca reflexa]
           gi|684184500|gb|AIM53688.1| photosystem II protein M
           (plastid) [Raddia brasiliensis]
           gi|684184670|gb|AIM53856.1| photosystem II protein M
           (plastid) [Buergersiochloa bambusoides]
           gi|684184754|gb|AIM53939.1| photosystem II protein M
           (plastid) [Chusquea liebmannii]
           gi|684184837|gb|AIM54022.1| photosystem II protein M
           (plastid) [Lithachne pauciflora]
           gi|684184918|gb|AIM54102.1| photosystem II protein M
           (plastid) [Otatea acuminata] gi|684185002|gb|AIM54186.1|
           photosystem II protein M (plastid) [Pariana radiciflora]
           gi|684185083|gb|AIM54266.1| photosystem II protein M
           (plastid) [Thamnocalamus spathiflorus]
           gi|685165213|gb|AIN81003.1| photosystem II protein M
           (chloroplast) [Zingiber officinale]
           gi|685844901|gb|AIP85225.1| PsbM (chloroplast) [Camellia
           sinensis] gi|687814849|gb|AIQ81091.1| photosystem II
           protein M (chloroplast) [Clematis terniflora]
           gi|690196836|gb|AIR12597.1| photosystem II protein M
           (plastid) [Bomarea edulis] gi|694174852|gb|AIS67526.1|
           photosystem II protein M (chloroplast) [Phragmipedium
           longifolium] gi|695277409|gb|AIT15986.1| photosystem II
           protein M (chloroplast) [Luzuriaga radicans]
           gi|699975230|gb|AIU44765.1| photosystem II protein M
           (chloroplast) [Phalaenopsis hybrid cultivar]
           gi|700744606|gb|AIU98530.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           gi|702068518|emb|CDI43995.1| photosystem II protein M
           (chloroplast) [Genlisea margaretae]
           gi|702068598|emb|CDL78730.1| photosystem II protein M
           (chloroplast) [Utricularia macrorhiza]
           gi|702075546|gb|AIW05429.1| photosystem II protein M
           [Neobracea bahamensis] gi|702075632|gb|AIW05514.1|
           photosystem II protein M [Nerium oleander]
           gi|702076061|gb|AIW05938.1| photosystem II protein M
           [Wrightia natalensis] gi|704001768|gb|AIW51833.1|
           photosystem II protein M (chloroplast) [Lasthenia
           burkei] gi|705244216|gb|AIW56411.1| photosystem II
           protein M (chloroplast) [Xerophyllum tenax]
           gi|705244323|gb|AIW56498.1| photosystem II protein M
           (chloroplast) [Heloniopsis tubiflora]
           gi|721136299|gb|AIX03510.1| photosystem II protein M
           (plastid) [Thalictrum coreanum]
           gi|723430233|gb|AIX89737.1| PsbM (chloroplast)
           [Fagopyrum tataricum] gi|725798280|emb|CED79756.1|
           photosystem II protein M (chloroplast) [Hesperelaea
           palmeri] gi|725824037|gb|AIY33816.1| photosystem II
           protein M (chloroplast) [Nelumbo nucifera]
           gi|731443633|gb|AIZ57527.1| photosystem II protein M
           (chloroplast) [Clematis fusca var. coreana]
           gi|734521315|gb|AJA05711.1| photosystem II protein M
           (plastid) [Castanea pumila var. pumila]
           gi|743432611|gb|AJC09129.1| PsbM (chloroplast) [Oryza
           sativa] gi|743432733|gb|AJC09228.1| PsbM (chloroplast)
           [Oryza sativa] gi|743432841|gb|AJC09327.1| PsbM
           (chloroplast) [Oryza sativa] gi|743432958|gb|AJC09427.1|
           PsbM (chloroplast) [Oryza glaberrima]
           gi|743433084|gb|AJC09527.1| PsbM (chloroplast) [Oryza
           barthii] gi|743433207|gb|AJC09627.1| PsbM (chloroplast)
           [Oryza rufipogon] gi|743433332|gb|AJC09727.1| PsbM
           (chloroplast) [Oryza meridionalis]
           gi|743433459|gb|AJC09827.1| PsbM (chloroplast) [Oryza
           glumipatula] gi|743433583|gb|AJC09927.1| PsbM
           (chloroplast) [Oryza punctata]
           gi|743433806|gb|AJC10101.1| PsbM (chloroplast) [Oryza
           glaberrima] gi|743433931|gb|AJC10201.1| PsbM
           (chloroplast) [Oryza barthii]
           gi|743434058|gb|AJC10301.1| PsbM (chloroplast) [Oryza
           barthii] gi|743434185|gb|AJC10401.1| PsbM (chloroplast)
           [Oryza barthii] gi|743434313|gb|AJC10501.1| PsbM
           (chloroplast) [Oryza barthii]
           gi|743434432|gb|AJC10601.1| PsbM (chloroplast) [Oryza
           sativa Indica Group] gi|744671465|gb|AJC99301.1| PsbM
           (chloroplast) [Oryza sativa Japonica Group]
           gi|744671577|gb|AJC99390.1| PsbM (chloroplast) [Oryza
           sativa Japonica Group] gi|744672012|gb|AJC99731.1| PsbM
           (chloroplast) [Oryza glaberrima]
           gi|744672139|gb|AJC99831.1| PsbM (chloroplast) [Oryza
           nivara] gi|744672262|gb|AJC99931.1| PsbM (chloroplast)
           [Oryza barthii] gi|744672388|gb|AJD00032.1| PsbM
           (chloroplast) [Oryza longistaminata]
           gi|746001364|dbj|BAQ19635.1| photosystem II protein M
           (chloroplast) [Ananas comosus]
           gi|746590299|gb|AJD76815.1| photosystem II protein M
           (chloroplast) [Lathraea squamaria]
           gi|748013898|gb|AJE28368.1| photosystem II protein M
           (chloroplast) [Premna microphylla]
           gi|748990766|gb|AJE71211.1| photosystem II protein M
           (plastid) [Acorus gramineus] gi|748992663|gb|AJE73083.1|
           photosystem II protein M (plastid) [Xanthisma
           spinulosum] gi|748992740|gb|AJE73159.1| photosystem II
           protein M (plastid) [Gutierrezia sarothrae]
           gi|748992817|gb|AJE73235.1| photosystem II protein M
           (plastid) [Liatris squarrosa]
           gi|748992971|gb|AJE73387.1| photosystem II protein M
           (plastid) [Erigeron strigosus]
           gi|748993125|gb|AJE73539.1| photosystem II protein M
           (plastid) [Cirsium undulatum]
           gi|748993202|gb|AJE73615.1| photosystem II protein M
           (plastid) [Solidago canadensis var. scabra]
           gi|748993279|gb|AJE73691.1| photosystem II protein M
           (plastid) [Erigeron philadelphicus]
           gi|748993356|gb|AJE73767.1| photosystem II protein M
           (plastid) [Heterotheca stenophylla]
           gi|748993510|gb|AJE73919.1| photosystem II protein M
           (plastid) [Vernonia baldwinii]
           gi|748993587|gb|AJE73995.1| photosystem II protein M
           (plastid) [Helenium flexuosum]
           gi|748993664|gb|AJE74071.1| photosystem II protein M
           (plastid) [Heterotheca villosa]
           gi|748993741|gb|AJE74147.1| photosystem II protein M
           (plastid) [Cirsium altissimum]
           gi|748993818|gb|AJE74223.1| photosystem II protein M
           (plastid) [Echinacea angustifolia]
           gi|748993895|gb|AJE74299.1| photosystem II protein M
           (plastid) [Helianthus petiolaris]
           gi|748994203|gb|AJE74603.1| photosystem II protein M
           (plastid) [Ratibida columnifera]
           gi|748994280|gb|AJE74679.1| photosystem II protein M
           (plastid) [Lygodesmia juncea]
           gi|748994357|gb|AJE74755.1| photosystem II protein M
           (plastid) [Hymenopappus tenuifolius]
           gi|748994434|gb|AJE74831.1| photosystem II protein M
           (plastid) [Cirsium canescens]
           gi|748994511|gb|AJE74907.1| photosystem II protein M
           (plastid) [Solidago gigantea]
           gi|748994665|gb|AJE75059.1| photosystem II protein M
           (plastid) [Erigeron bellidiastrum]
           gi|748994742|gb|AJE75135.1| photosystem II protein M
           (plastid) [Tragopogon dubius]
           gi|756141160|gb|AJK90741.1| photosystem II protein M
           (chloroplast) [Capsicum lycianthoides]
           gi|756419264|gb|AJL34403.1| photosystem II protein M
           (chloroplast) [Dunalia obovata]
           gi|756761936|gb|AJM70051.1| photosystem II protein M
           (chloroplast) [Chloranthus japonicus]
           gi|756761982|gb|AJM70094.1| photosystem II protein M
           (chloroplast) [Iochroma nitidum]
           gi|757173485|gb|AJN90300.1| photosystem II protein M
           [Physalis peruviana] gi|757173706|gb|AJN90500.1|
           photosystem II protein M (chloroplast) [Iochroma
           stenanthum] gi|757174606|gb|AJN91009.1| photosystem II
           protein M [Lithocarpus balansae]
           gi|757813341|gb|AJO25106.1| photosystem II protein M
           (chloroplast) [Solanum lycopersicum]
           gi|757815099|gb|AJO26081.1| photosystem II protein M
           (chloroplast) [Actinidia chinensis]
           gi|757815183|gb|AJO26164.1| photosystem II protein M
           (chloroplast) [Actinidia chinensis]
           gi|757815267|gb|AJO26247.1| photosystem II protein M
           (chloroplast) [Actinidia deliciosa]
           gi|757815351|gb|AJO26330.1| photosystem II protein M
           (chloroplast) [Actinidia chinensis]
           gi|758185500|gb|AJO61575.1| photosystem II protein M
           (chloroplast) [Saracha punctata]
           gi|760173524|gb|AJP09557.1| photosystem II protein M
           (chloroplast) [Ipomoea batatas]
           gi|761231254|gb|AJP33663.1| photosystem II protein M
           (chloroplast) [Oryza barthii]
           gi|761231337|gb|AJP33745.1| photosystem II protein M
           (chloroplast) [Oryza barthii]
           gi|761231420|gb|AJP33827.1| photosystem II protein M
           (chloroplast) [Oryza barthii]
           gi|761231503|gb|AJP33909.1| photosystem II protein M
           (chloroplast) [Oryza barthii]
           gi|761231587|gb|AJP33992.1| photosystem II protein M
           (chloroplast) [Oryza glaberrima]
           gi|761231669|gb|AJP34073.1| photosystem II protein M
           (chloroplast) [Oryza glaberrima]
           gi|761231753|gb|AJP34156.1| photosystem II protein M
           (chloroplast) [Oryza glumipatula]
           gi|761231837|gb|AJP34239.1| photosystem II protein M
           (chloroplast) [Oryza longistaminata]
           gi|761231921|gb|AJP34322.1| photosystem II protein M
           (chloroplast) [Oryza longistaminata]
           gi|761232005|gb|AJP34405.1| photosystem II protein M
           (chloroplast) [Oryza officinalis]
           gi|765365545|gb|AJR30373.1| photosystem II protein M
           (chloroplast) [Vassobia breviflora]
           gi|766543995|gb|AJS14248.1| photosystem II protein M
           (chloroplast) [Iochroma loxense]
           gi|766544081|gb|AJS14332.1| photosystem II protein M
           (chloroplast) [Iochroma calycinum]
           gi|766544163|gb|AJS14413.1| photosystem II protein M
           [Ruellia breedlovei] gi|768803790|gb|AJV88590.1|
           photosystem II protein M (chloroplast) [Carludovica
           palmata] gi|768804314|gb|AJV89101.1| photosystem II
           protein M (plastid) [Avena sativa]
           gi|768804482|gb|AJV89267.1| photosystem II protein M
           (plastid) [Brachyelytrum aristosum]
           gi|768804823|gb|AJV89604.1| photosystem II protein M
           (plastid) [Diarrhena obovata]
           gi|768805075|gb|AJV89853.1| photosystem II protein M
           (plastid) [Melica mutica] gi|768805159|gb|AJV89936.1|
           photosystem II protein M (plastid) [Melica subulata]
           gi|768805328|gb|AJV90103.1| photosystem II protein M
           (plastid) [Phaenosperma globosum]
           gi|768805412|gb|AJV90186.1| photosystem II protein M
           (plastid) [Phalaris arundinacea]
           gi|769471221|gb|AJW60142.1| photosystem II protein M
           (chloroplast) [Quercus aliena]
           gi|770591252|gb|AJW75044.1| photosystem II protein M
           (chloroplast) [Vassobia dichotoma]
           gi|779776212|gb|AJY78686.1| photosystem II protein M
           (chloroplast) [Solanum cheesmaniae]
           gi|779776301|gb|AJY78769.1| photosystem II protein M
           (chloroplast) [Solanum chilense]
           gi|779776391|gb|AJY78852.1| photosystem II protein M
           (chloroplast) [Solanum galapagense]
           gi|779776482|gb|AJY78935.1| photosystem II protein M
           (chloroplast) [Solanum habrochaites]
           gi|779776572|gb|AJY79018.1| photosystem II protein M
           (chloroplast) [Solanum lycopersicum]
           gi|779776663|gb|AJY79101.1| photosystem II protein M
           (chloroplast) [Solanum neorickii]
           gi|779776753|gb|AJY79184.1| photosystem II protein M
           (chloroplast) [Solanum peruvianum]
           gi|779776843|gb|AJY79267.1| photosystem II protein M
           (chloroplast) [Solanum pimpinellifolium]
           gi|800876046|gb|AKA66526.1| photosystem II protein M
           (chloroplast) [Dunalia brachyacantha]
           gi|800876824|gb|AKA66957.1| photosystem II protein M
           (chloroplast) [Quercus spinosa]
           gi|806935424|gb|AKC05463.1| photosystem II protein M
           (chloroplast) [Quercus aquifolioides]
           gi|808781951|gb|AKE07330.1| photosystem II protein M
           (plastid) [Guadua weberbaueri]
           gi|816377917|gb|AKF00569.1| photosystem II protein M
           (chloroplast) [Reinhardtia paiewonskiana]
           gi|816378184|gb|AKF00832.1| photosystem II protein M
           (chloroplast) [Veitchia spiralis]
           gi|816378271|gb|AKF00918.1| photosystem II protein M
           (chloroplast) [Areca vestiaria]
           gi|816379351|gb|AKF01984.1| photosystem II protein M
           (chloroplast) [Manicaria saccifera]
           gi|817161702|gb|AKF33684.1| photosystem II protein M
           (chloroplast) [Dioscorea zingiberensis]
           gi|817597846|gb|AKF78406.1| photosystem II protein M
           (chloroplast) [Dunalia solanacea]
           gi|819231885|gb|AKG49782.1| photosystem II protein M
           (chloroplast) [Cynara humilis]
           gi|820957685|gb|AKH02193.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           gi|820957808|gb|AKH02313.1| photosystem II protein M
           (chloroplast) [Iochroma tingoanum]
           gi|821158490|gb|AKH04419.1| photosystem II protein M
           (plastid) [Chusquea circinata]
           gi|821158575|gb|AKH04503.1| photosystem II protein M
           (plastid) [Chusquea sp. PFM-2015]
           gi|821158660|gb|AKH04587.1| photosystem II protein M
           (plastid) [Otatea glauca] gi|821158745|gb|AKH04671.1|
           photosystem II protein M (plastid) [Pariana campestris]
           gi|821158829|gb|AKH04754.1| photosystem II protein M
           (plastid) [Pariana radiciflora]
           gi|821158913|gb|AKH04837.1| photosystem II protein M
           (plastid) [Pariana sp. PFM-2015]
           gi|821607396|gb|AKH49622.1| photosystem II protein M
           (chloroplast) [Chikusichloa aquatica]
           gi|825715651|gb|AKJ25292.1| photosystem II protein M
           (plastid) [Carex siderosticta]
           gi|827345213|gb|AKJ76797.1| PSII M protein (chloroplast)
           [Rosmarinus officinalis] gi|827345910|gb|AKJ77211.1|
           photosystem II M protein (chloroplast) [Scutellaria
           baicalensis] gi|827346279|gb|AKJ77478.1| photosystem II
           protein M (chloroplast) [Carthamus tinctorius]
           gi|827346360|gb|AKJ77557.1| photosystem II protein M
           (chloroplast) [Dioscorea nipponica]
           gi|827346446|gb|AKJ77638.1| photosystem II protein M
           (chloroplast) [Fagopyrum cymosum]
           gi|827346549|gb|AKJ77735.1| photosystem II protein M
           (chloroplast) [Perilla frutescens]
           gi|827504919|gb|AKJ83505.1| photosystem II protein M
           (chloroplast) [Dieffenbachia seguine]
           gi|827505774|gb|AKJ83761.1| photosystem II protein M
           (chloroplast) [Pinellia ternata]
           gi|827520951|gb|AKJ85808.1| photosystem II protein M
           (chloroplast) [Podococcus barteri]
           gi|833204615|gb|AKM21853.1| PsbM (chloroplast) [Solanum
           commersonii] gi|833204741|gb|AKM21939.1| PsbM
           (chloroplast) [Solanum nigrum]
           gi|833204878|gb|AKM22025.1| PsbM (chloroplast) [Solanum
           tuberosum] gi|844170158|gb|AKM98154.1| photosystem II M
           protein (chloroplast) [Anemone patens]
           gi|844170281|gb|AKM98242.1| photosystem II M protein
           (chloroplast) [Anemone patens]
           gi|844170407|gb|AKM98330.1| photosystem II M protein
           (chloroplast) [Pulsatilla pratensis]
           gi|844170529|gb|AKM98418.1| photosystem II M protein
           (chloroplast) [Pulsatilla pratensis]
           gi|844170661|gb|AKM98506.1| photosystem II M protein
           (chloroplast) [Pulsatilla vernalis]
           gi|844170802|gb|AKM98594.1| photosystem II M protein
           (chloroplast) [Pulsatilla vernalis]
           gi|887513810|gb|AKQ49257.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. altilis]
           gi|887513898|gb|AKQ49344.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. altilis]
           gi|887513986|gb|AKQ49431.1| photosystem II protein M
           (chloroplast) [Cynara baetica]
           gi|887514074|gb|AKQ49518.1| photosystem II protein M
           (chloroplast) [Cynara cornigera]
           gi|887514162|gb|AKQ49605.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           gi|887514250|gb|AKQ49692.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           gi|887514338|gb|AKQ49779.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           gi|887514426|gb|AKQ49866.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           gi|887514514|gb|AKQ49953.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           gi|887514602|gb|AKQ50040.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           gi|887514690|gb|AKQ50127.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           gi|887514778|gb|AKQ50214.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           gi|887514866|gb|AKQ50301.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           gi|887514954|gb|AKQ50388.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           gi|887515042|gb|AKQ50475.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           gi|887515130|gb|AKQ50562.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           gi|887515218|gb|AKQ50649.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           gi|887515306|gb|AKQ50736.1| photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           gi|887515394|gb|AKQ50823.1| photosystem II protein M
           (chloroplast) [Cynara syriaca]
           gi|896560951|gb|AKR06841.1| photosystem II protein M
           (chloroplast) [Carnegiea gigantea]
           gi|902573686|gb|AKR80586.1| photosystem II protein M
           (plastid) [Sararanga sinuosa]
           gi|902573977|gb|AKR80709.1| photosystem II protein M
           (plastid) [Croomia japonica] gi|902574224|gb|AKR80809.1|
           photosystem II protein M (plastid) [Xerophyta
           retinervis] gi|902574665|gb|AKR80991.1| photosystem II
           protein M (plastid) [Stichoneuron caudatum]
           gi|902574840|gb|AKR81062.1| photosystem II protein M
           (plastid) [Pentastemona sumatrana]
           gi|902575136|gb|AKR81185.1| photosystem II protein M
           (plastid) [Freycinetia banksii]
           gi|902575230|gb|AKR81222.1| photosystem II protein M
           (plastid) [Cyclanthus bipartitus]
           gi|906347049|gb|AKS28765.1| photosystem II protein M
           (chloroplast) [Capsella rubella]
           gi|909719393|gb|AKT93688.1| photosystem II protein M
           (chloroplast) [Rheum palmatum]
           gi|910750179|gb|AKU47126.1| photosystem II protein M
           (chloroplast) [Ananas comosus]
           gi|916441083|gb|AKZ23246.1| photosystem II protein M
           (plastid) [Carduus nutans] gi|916441085|gb|AKZ23247.1|
           photosystem II protein M (plastid) [Vernonia baldwinii]
           gi|916441087|gb|AKZ23248.1| photosystem II protein M
           (plastid) [Helianthus pauciflorus subsp. subrhomboideus]
           gi|916441089|gb|AKZ23249.1| photosystem II protein M
           (plastid) [Helianthus tuberosus]
           gi|916441091|gb|AKZ23250.1| photosystem II protein M
           (plastid) [Rudbeckia hirta var. pulcherrima]
           gi|916441093|gb|AKZ23251.1| photosystem II protein M
           (plastid) [Silphium integrifolium]
           gi|916441095|gb|AKZ23252.1| photosystem II protein M
           (plastid) [Heliopsis helianthoides var. occidentalis]
           gi|916441097|gb|AKZ23253.1| photosystem II protein M
           (plastid) [Grindelia squarrosa var. squarrosa]
           gi|916441099|gb|AKZ23254.1| photosystem II protein M
           (plastid) [Solidago missouriensis]
           gi|916441107|gb|AKZ23258.1| photosystem II protein M
           (plastid) [Symphoricarpos occidentalis]
           gi|916441111|gb|AKZ23260.1| photosystem II protein M
           (plastid) [Physalis heterophylla]
           gi|916441113|gb|AKZ23261.1| photosystem II protein M
           (plastid) [Physalis virginiana]
           gi|916441115|gb|AKZ23262.1| photosystem II protein M
           (plastid) [Solanum carolinense]
           gi|916441117|gb|AKZ23263.1| photosystem II protein M
           (plastid) [Solanum rostratum]
           gi|916441119|gb|AKZ23264.1| photosystem II protein M
           (plastid) [Solanum triflorum]
           gi|916441121|gb|AKZ23265.1| photosystem II protein M
           (plastid) [Monarda fistulosa var. mollis]
           gi|916441123|gb|AKZ23266.1| photosystem II protein M
           (plastid) [Salvia nemorosa] gi|916441125|gb|AKZ23267.1|
           photosystem II protein M (plastid) [Nepeta cataria]
           gi|916441135|gb|AKZ23272.1| photosystem II protein M
           (plastid) [Verbena hastata] gi|916441137|gb|AKZ23273.1|
           photosystem II protein M (plastid) [Veronica americana]
           gi|916441141|gb|AKZ23275.1| photosystem II protein M
           (plastid) [Convolvulus arvensis]
           gi|916441143|gb|AKZ23276.1| photosystem II protein M
           (plastid) [Ipomoea leptophylla]
           gi|916441145|gb|AKZ23277.1| photosystem II protein M
           (plastid) [Evolvulus nuttallianus]
           gi|916441153|gb|AKZ23281.1| photosystem II protein M
           (plastid) [Silene antirrhina]
           gi|916441155|gb|AKZ23282.1| photosystem II protein M
           (plastid) [Silene vulgaris] gi|917544753|gb|AKZ30106.1|
           photosystem II protein M (chloroplast) [Selliera
           radicans] gi|917544813|gb|AKZ30165.1| photosystem II
           protein M (chloroplast) [Velleia rosea]
           gi|917544880|gb|AKZ30231.1| photosystem II protein M
           (chloroplast) [Goodenia helmsii]
           gi|917545014|gb|AKZ30363.1| photosystem II protein M
           (chloroplast) [Goodenia hassallii]
           gi|917545081|gb|AKZ30429.1| photosystem II protein M
           (chloroplast) [Goodenia pinifolia]
           gi|917545149|gb|AKZ30496.1| photosystem II protein M
           (chloroplast) [Goodenia viscida]
           gi|917545216|gb|AKZ30562.1| photosystem II protein M
           (chloroplast) [Velleia discophora]
           gi|917545283|gb|AKZ30628.1| photosystem II protein M
           (chloroplast) [Goodenia drummondii]
           gi|917545350|gb|AKZ30694.1| photosystem II protein M
           (chloroplast) [Velleia foliosa]
           gi|917545485|gb|AKZ30827.1| photosystem II protein M
           (chloroplast) [Goodenia tripartita]
           gi|917545615|gb|AKZ30955.1| photosystem II protein M
           (chloroplast) [Goodenia filiformis]
           gi|917545751|gb|AKZ31089.1| photosystem II protein M
           (chloroplast) [Goodenia decursiva]
           gi|917545819|gb|AKZ31156.1| photosystem II protein M
           (chloroplast) [Scaevola collaris]
           gi|917545878|gb|AKZ31214.1| photosystem II protein M
           (chloroplast) [Goodenia micrantha]
           gi|917546016|gb|AKZ31350.1| photosystem II protein M
           (chloroplast) [Coopernookia polygalacea]
           gi|917546083|gb|AKZ31416.1| photosystem II protein M
           (chloroplast) [Coopernookia strophiolata]
           gi|917546148|gb|AKZ31480.1| photosystem II protein M
           (chloroplast) [Verreauxia reinwardtii]
           gi|917546215|gb|AKZ31546.1| photosystem II protein M
           (chloroplast) [Goodenia phillipsiae]
           gi|924254284|gb|ALB38577.1| photosystem II protein M
           (chloroplast) [Epipremnum aureum]
           gi|924443718|gb|ALB78253.1| photosystem II protein M
           (chloroplast) [Tanaecium tetragonolobum]
           gi|926657946|gb|ALD50097.1| PsbM (chloroplast) [Capsicum
           annuum var. glabriusculum] gi|926658033|gb|ALD50183.1|
           PsbM (chloroplast) [Capsicum frutescens]
           gi|926658120|gb|ALD50269.1| PsbM (chloroplast) [Capsicum
           annuum var. annuum] gi|926658207|gb|ALD50355.1| PsbM
           (chloroplast) [Capsicum baccatum var. baccatum]
           gi|927679584|gb|ALE28961.1| photosystem II protein M
           (plastid) [Colpothrinax cookii]
           gi|929982670|gb|ALF35924.1| photosystem II protein M
           (chloroplast) [Oryza sativa Aromatic Japonica Group]
           gi|929982748|gb|ALF36001.1| photosystem II protein M
           (chloroplast) [Oryza sativa Tropical Japonica Group]
           gi|930616960|gb|ALF99697.1| photosystem II protein M
           (chloroplast) [Colobanthus quitensis]
           gi|937501422|gb|ALI31134.1| photosystem II protein M
           (chloroplast) [Solanum nigrum]
           gi|938485362|gb|ALJ49590.1| photosystem II protein M
           (chloroplast) [Pseudosasa japonica]
           gi|938485440|gb|ALJ49667.1| photosystem II protein M
           (chloroplast) [Pseudosasa japonica]
           gi|939462085|gb|ALJ78244.1| photosystem II protein M
           (plastid) [Plantago maritima]
           gi|939462182|gb|ALJ78340.1| photosystem II protein M
           (plastid) [Plantago media] gi|940813710|gb|ALK26610.1|
           photosystem II protein M (chloroplast) [Ostrya
           rehderiana] gi|943496726|gb|ALL53067.1| photosystem II
           protein M (chloroplast) [Bletilla striata]
           gi|944544145|gb|ALL97035.1| photosystem II protein M
           (chloroplast) [Musa balbisiana]
           gi|949600113|gb|ALN11567.1| photosystem II protein M
           (chloroplast) [Iochroma edule]
           gi|949600146|gb|ALN11597.1| photosystem II protein M
           (chloroplast) [Scutellaria insignis]
           gi|952109234|gb|ALN98165.1| photosystem II protein M
           (chloroplast) [Dendrobium chrysotoxum]
           gi|226687|prf||1603356M photosystem II low MW protein
           [Oryza sativa]
          Length = 34

 Score = 62.0 bits (149), Expect = 2e-07
 Identities = 32/34 (94%), Positives = 32/34 (94%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           MEVNILA  ATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34


>ref|YP_009122581.1| photosystem II protein M (chloroplast) [Masdevallia coccinea]
           gi|806636810|ref|YP_009129686.1| photosystem II protein
           M (chloroplast) [Masdevallia picturata]
           gi|657406393|gb|AID52112.1| photosystem II protein M
           (chloroplast) [Masdevallia picturata]
           gi|755161259|gb|AJJ48511.1| photosystem II protein M
           (chloroplast) [Masdevallia coccinea]
          Length = 34

 Score = 62.0 bits (149), Expect = 2e-07
 Identities = 32/34 (94%), Positives = 32/34 (94%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           MEVNILAL AT LFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILALIATTLFILVPTAFLLIIYVKTVSQND 34


>ref|YP_009109128.1| photosystem II protein M (plastid) [Corallorhiza trifida]
           gi|704001484|gb|AIW51597.1| photosystem II protein M
           (plastid) [Corallorhiza trifida]
          Length = 34

 Score = 62.0 bits (149), Expect = 2e-07
 Identities = 32/34 (94%), Positives = 32/34 (94%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           MEVNI AL ATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNIFALIATALFILVPTAFLLIIYVKTVSQND 34


>gb|AKZ30297.1| photosystem II protein M (chloroplast) [Goodenia ovata]
          Length = 34

 Score = 61.6 bits (148), Expect = 2e-07
 Identities = 31/34 (91%), Positives = 32/34 (94%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           MEVNILA  ATALF+LVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATALFVLVPTAFLLIIYVKTVSQND 34


>ref|YP_009108753.1| photosystem II protein M [Oncinotis tenuiloba]
           gi|725666010|ref|YP_009108583.1| photosystem II protein
           M [Echites umbellatus] gi|813423496|ref|YP_009130955.1|
           photosystem II M protein (chloroplast) [Lonicera
           japonica] gi|814072131|ref|YP_009129849.1| photosystem
           II protein M (chloroplast) [Paphiopedilum armeniacum]
           gi|290488068|gb|ADD30418.1| photosystem II protein M
           (chloroplast) [Aucuba japonica]
           gi|290488076|gb|ADD30422.1| photosystem II protein M
           (chloroplast) [Lonicera japonica]
           gi|290488094|gb|ADD30431.1| photosystem II protein M
           (chloroplast) [Cornus florida]
           gi|599088068|gb|AHN52972.1| photosystem II M protein
           (chloroplast) [Lonicera japonica]
           gi|657406546|gb|AID52263.1| photosystem II protein M
           (chloroplast) [Paphiopedilum armeniacum]
           gi|702075289|gb|AIW05175.1| photosystem II protein M
           [Aganosma cymosa] gi|702075375|gb|AIW05260.1|
           photosystem II protein M [Echites umbellatus]
           gi|702075461|gb|AIW05345.1| photosystem II protein M
           [Epigynum auritum] gi|702075718|gb|AIW05599.1|
           photosystem II protein M [Oncinotis tenuiloba]
           gi|761631451|gb|AJP62104.1| photosystem II protein M
           (chloroplast) [Dianthus longicalyx]
           gi|916441133|gb|AKZ23271.1| photosystem II protein M
           (plastid) [Teucrium canadense]
           gi|937957688|gb|ALJ02069.1| photosystem II protein M
           (chloroplast) [Paphiopedilum armeniacum]
          Length = 34

 Score = 61.6 bits (148), Expect = 2e-07
 Identities = 31/34 (91%), Positives = 32/34 (94%)
 Frame = +2

Query: 170 MEVNILALSATALFILVPTAFLLIIYVKTVSQND 271
           MEVNILA  ATALFILVPTAFLLIIYVKT+SQND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTISQND 34


Top