BLASTX nr result
ID: Ophiopogon21_contig00039384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00039384 (506 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006375041.1| hypothetical protein POPTR_0014s03850g [Popu... 53 1e-05 >ref|XP_006375041.1| hypothetical protein POPTR_0014s03850g [Populus trichocarpa] gi|550323355|gb|ERP52838.1| hypothetical protein POPTR_0014s03850g [Populus trichocarpa] Length = 299 Score = 52.8 bits (125), Expect(2) = 1e-05 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 387 LLMQAIIGCRFFTLIAVVGSLVGSILGFVEGCFLM 491 L+ +AII CRFFTL AV GSL+GS L FVEGCFL+ Sbjct: 118 LIEKAIIDCRFFTLFAVAGSLLGSTLCFVEGCFLI 152 Score = 23.1 bits (48), Expect(2) = 1e-05 Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 226 VASLLVHIRRAPREILKPPDTRS--WPLLAEIAVDQA 330 +ASLL + A ++L+PP ++S W + +++A Sbjct: 86 LASLLATVSNALLKVLRPPASKSKQWKFQVQKLIEKA 122