BLASTX nr result
ID: Ophiopogon21_contig00039148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00039148 (941 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010921143.1| PREDICTED: taxane 13-alpha-hydroxylase-like ... 72 8e-10 ref|XP_008782776.1| PREDICTED: cytochrome P450 716B1-like [Phoen... 65 1e-07 >ref|XP_010921143.1| PREDICTED: taxane 13-alpha-hydroxylase-like isoform X1 [Elaeis guineensis] Length = 499 Score = 71.6 bits (174), Expect = 8e-10 Identities = 34/63 (53%), Positives = 42/63 (66%) Frame = +1 Query: 589 LYSLPHPLLESQPLLLFIALVTLGVIFGSYHRFKISPSQAKRLPPSSLGFPFFGETIGFL 768 L+ L H +ESQP+ L + LV +GV+FG Y+RFK LPP SLG P FGETI FL Sbjct: 5 LFGLLHLSIESQPVFLAVVLVIVGVLFGRYYRFKTFSLHGTSLPPGSLGLPLFGETISFL 64 Query: 769 RAQ 777 +AQ Sbjct: 65 KAQ 67 >ref|XP_008782776.1| PREDICTED: cytochrome P450 716B1-like [Phoenix dactylifera] Length = 498 Score = 64.7 bits (156), Expect = 1e-07 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = +1 Query: 613 LESQPLLLFIALVTLGVIFGSYHRFKISPSQAKRLPPSSLGFPFFGETIGFLRAQR 780 +ESQP+LL +G++FG Y+ FK KRLPP SLG P FGE+I FL+AQ+ Sbjct: 13 IESQPVLLAAVPAIVGILFGGYYMFKTFSFHGKRLPPGSLGLPLFGESISFLKAQK 68