BLASTX nr result
ID: Ophiopogon21_contig00039075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00039075 (396 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008798782.1| PREDICTED: WD repeat-containing protein WRAP... 80 8e-13 ref|XP_010919687.1| PREDICTED: WD repeat-containing protein WRAP... 79 2e-12 ref|XP_010919686.1| PREDICTED: WD repeat-containing protein WRAP... 79 2e-12 gb|AEZ00906.1| putative WD-40 repeat protein family, partial [El... 79 2e-12 ref|XP_004983643.1| PREDICTED: WD repeat-containing protein WRAP... 77 5e-12 ref|XP_006662066.1| PREDICTED: WD repeat-containing protein WRAP... 77 7e-12 ref|XP_004496089.1| PREDICTED: WD repeat-containing protein WRAP... 76 1e-11 ref|XP_010662257.1| PREDICTED: WD repeat-containing protein WRAP... 76 1e-11 ref|NP_001065400.1| Os10g0563300 [Oryza sativa Japonica Group] g... 75 2e-11 ref|XP_006837349.1| PREDICTED: WD repeat-containing protein WRAP... 75 2e-11 ref|XP_011022359.1| PREDICTED: WD repeat-containing protein WRAP... 75 3e-11 ref|XP_011022358.1| PREDICTED: WD repeat-containing protein WRAP... 75 3e-11 ref|XP_006421552.1| hypothetical protein CICLE_v10004937mg [Citr... 75 3e-11 gb|KRG92176.1| hypothetical protein GLYMA_20G1956001, partial [G... 74 3e-11 ref|XP_003556319.1| PREDICTED: WD repeat-containing protein WRAP... 74 3e-11 ref|XP_012439109.1| PREDICTED: WD repeat-containing protein WRAP... 74 4e-11 gb|KJB51376.1| hypothetical protein B456_008G214300 [Gossypium r... 74 4e-11 gb|KJB51374.1| hypothetical protein B456_008G214300 [Gossypium r... 74 4e-11 gb|KHG28715.1| WD repeat-containing WRAP73 [Gossypium arboreum] 74 4e-11 ref|XP_006490193.1| PREDICTED: WD repeat-containing protein WRAP... 74 4e-11 >ref|XP_008798782.1| PREDICTED: WD repeat-containing protein WRAP73 [Phoenix dactylifera] Length = 465 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAMESVL 262 SGACCVSIPLP + DLKWNSDGSCLLLKD+ESFCCAA+ S+L Sbjct: 411 SGACCVSIPLPNFVIYDLKWNSDGSCLLLKDRESFCCAAVVSML 454 >ref|XP_010919687.1| PREDICTED: WD repeat-containing protein WRAP73 isoform X2 [Elaeis guineensis] Length = 427 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAMESVL 262 SGACCV+IPLP + DLKWNSDGSCLLLKD+ESFCCAA+ S+L Sbjct: 373 SGACCVNIPLPNFVIYDLKWNSDGSCLLLKDRESFCCAAVVSML 416 >ref|XP_010919686.1| PREDICTED: WD repeat-containing protein WRAP73 isoform X1 [Elaeis guineensis] Length = 465 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAMESVL 262 SGACCV+IPLP + DLKWNSDGSCLLLKD+ESFCCAA+ S+L Sbjct: 411 SGACCVNIPLPNFVIYDLKWNSDGSCLLLKDRESFCCAAVVSML 454 >gb|AEZ00906.1| putative WD-40 repeat protein family, partial [Elaeis guineensis] Length = 255 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAMESVL 262 SGACCV+IPLP + DLKWNSDGSCLLLKD+ESFCCAA+ S+L Sbjct: 201 SGACCVNIPLPNFVIYDLKWNSDGSCLLLKDRESFCCAAVVSML 244 >ref|XP_004983643.1| PREDICTED: WD repeat-containing protein WRAP73 [Setaria italica] gi|944225501|gb|KQK89905.1| hypothetical protein SETIT_035522mg [Setaria italica] Length = 470 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAMESVL 262 SGACCV+IPLP + DLKWNSDGSCLLLKD++SFCCAA+ S L Sbjct: 412 SGACCVNIPLPNFRIVDLKWNSDGSCLLLKDRDSFCCAAIVSAL 455 >ref|XP_006662066.1| PREDICTED: WD repeat-containing protein WRAP73-like [Oryza brachyantha] Length = 469 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAMESVL 262 SGACCV+IPLP V DLKWNSDGSCLLLKD++SFCCAA+ S L Sbjct: 411 SGACCVNIPLPNFRVVDLKWNSDGSCLLLKDRDSFCCAAIVSPL 454 >ref|XP_004496089.1| PREDICTED: WD repeat-containing protein WRAP73 isoform X2 [Cicer arietinum] gi|828304673|ref|XP_012570070.1| PREDICTED: WD repeat-containing protein WRAP73 isoform X1 [Cicer arietinum] Length = 458 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGA CV +PLPK +TDLKWNSDGSCLLLKDKESFCCAA+ Sbjct: 406 SGAFCVHVPLPKFSITDLKWNSDGSCLLLKDKESFCCAAV 445 >ref|XP_010662257.1| PREDICTED: WD repeat-containing protein WRAP73 [Vitis vinifera] gi|731422841|ref|XP_010662258.1| PREDICTED: WD repeat-containing protein WRAP73 [Vitis vinifera] gi|297745032|emb|CBI38624.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGA CVS PLP+ VTDLKWNSDGSCLLLKDKESFCCAAM Sbjct: 406 SGAYCVSNPLPQFSVTDLKWNSDGSCLLLKDKESFCCAAM 445 >ref|NP_001065400.1| Os10g0563300 [Oryza sativa Japonica Group] gi|12597885|gb|AAG60193.1|AC084763_13 putative WD40 protein [Oryza sativa Japonica Group] gi|31433536|gb|AAP55034.1| WD-repeat protein 8, putative, expressed [Oryza sativa Japonica Group] gi|113639932|dbj|BAF27237.1| Os10g0563300 [Oryza sativa Japonica Group] gi|125532972|gb|EAY79537.1| hypothetical protein OsI_34666 [Oryza sativa Indica Group] gi|125575708|gb|EAZ16992.1| hypothetical protein OsJ_32477 [Oryza sativa Japonica Group] gi|937937165|dbj|BAT12079.1| Os10g0563300 [Oryza sativa Japonica Group] Length = 470 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAMESVL 262 SGACCV++PLP V DLKWNSDG+CLLLKD++SFCCAA+ S L Sbjct: 411 SGACCVNVPLPNFRVVDLKWNSDGTCLLLKDRDSFCCAAIVSPL 454 >ref|XP_006837349.1| PREDICTED: WD repeat-containing protein WRAP73 [Amborella trichopoda] gi|548839967|gb|ERN00203.1| hypothetical protein AMTR_s00111p00096320 [Amborella trichopoda] Length = 463 Score = 75.1 bits (183), Expect = 2e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGACCVS+PLP V+DLKWNSDGSC+LLKDKE+FCCA++ Sbjct: 411 SGACCVSVPLPDFSVSDLKWNSDGSCVLLKDKEAFCCASV 450 >ref|XP_011022359.1| PREDICTED: WD repeat-containing protein WRAP73-like isoform X2 [Populus euphratica] gi|743940198|ref|XP_011014564.1| PREDICTED: WD repeat-containing protein WRAP73-like isoform X2 [Populus euphratica] Length = 455 Score = 74.7 bits (182), Expect = 3e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGACCVS PLP+ + DLKWNSDGSCLLLKDK+SFCCAA+ Sbjct: 403 SGACCVSNPLPQFNINDLKWNSDGSCLLLKDKDSFCCAAV 442 >ref|XP_011022358.1| PREDICTED: WD repeat-containing protein WRAP73-like isoform X1 [Populus euphratica] gi|743940196|ref|XP_011014563.1| PREDICTED: WD repeat-containing protein WRAP73-like isoform X1 [Populus euphratica] Length = 458 Score = 74.7 bits (182), Expect = 3e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGACCVS PLP+ + DLKWNSDGSCLLLKDK+SFCCAA+ Sbjct: 406 SGACCVSNPLPQFNINDLKWNSDGSCLLLKDKDSFCCAAV 445 >ref|XP_006421552.1| hypothetical protein CICLE_v10004937mg [Citrus clementina] gi|557523425|gb|ESR34792.1| hypothetical protein CICLE_v10004937mg [Citrus clementina] Length = 458 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAME 271 SGA CVS PLP+ +TDLKWNSDGSCLLLKDKESFCCAA++ Sbjct: 406 SGAYCVSNPLPQFNITDLKWNSDGSCLLLKDKESFCCAALD 446 >gb|KRG92176.1| hypothetical protein GLYMA_20G1956001, partial [Glycine max] gi|947042453|gb|KRG92177.1| hypothetical protein GLYMA_20G1956001, partial [Glycine max] Length = 419 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGA CV +PLP+ +TDLKWNSDGSCLLLKDKESFCCAA+ Sbjct: 367 SGAYCVHVPLPQFTITDLKWNSDGSCLLLKDKESFCCAAV 406 >ref|XP_003556319.1| PREDICTED: WD repeat-containing protein WRAP73-like [Glycine max] Length = 458 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGA CV +PLP+ +TDLKWNSDGSCLLLKDKESFCCAA+ Sbjct: 406 SGAYCVHVPLPQFTITDLKWNSDGSCLLLKDKESFCCAAV 445 >ref|XP_012439109.1| PREDICTED: WD repeat-containing protein WRAP73 [Gossypium raimondii] gi|763784307|gb|KJB51378.1| hypothetical protein B456_008G214300 [Gossypium raimondii] Length = 457 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGA CVS PLP+ +TDLKWNSDGSCLLLKDKESFCCAA+ Sbjct: 405 SGAYCVSNPLPQFSITDLKWNSDGSCLLLKDKESFCCAAV 444 >gb|KJB51376.1| hypothetical protein B456_008G214300 [Gossypium raimondii] Length = 387 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGA CVS PLP+ +TDLKWNSDGSCLLLKDKESFCCAA+ Sbjct: 335 SGAYCVSNPLPQFSITDLKWNSDGSCLLLKDKESFCCAAV 374 >gb|KJB51374.1| hypothetical protein B456_008G214300 [Gossypium raimondii] Length = 294 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGA CVS PLP+ +TDLKWNSDGSCLLLKDKESFCCAA+ Sbjct: 242 SGAYCVSNPLPQFSITDLKWNSDGSCLLLKDKESFCCAAV 281 >gb|KHG28715.1| WD repeat-containing WRAP73 [Gossypium arboreum] Length = 457 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAM 274 SGA CVS PLP+ +TDLKWNSDGSCLLLKDKESFCCAA+ Sbjct: 405 SGAYCVSNPLPQFSITDLKWNSDGSCLLLKDKESFCCAAV 444 >ref|XP_006490193.1| PREDICTED: WD repeat-containing protein WRAP73-like [Citrus sinensis] Length = 458 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 393 SGACCVSIPLPKCFVTDLKWNSDGSCLLLKDKESFCCAAME 271 SGA CVS PLP+ +TDLKWNSDGSCLLLKDKESFCCAA++ Sbjct: 406 SGAYCVSNPLPQFNLTDLKWNSDGSCLLLKDKESFCCAALD 446