BLASTX nr result
ID: Ophiopogon21_contig00038762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00038762 (392 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010930369.1| PREDICTED: protein root UVB sensitive 6 [Ela... 59 1e-06 ref|XP_010908139.1| PREDICTED: protein root UVB sensitive 6-like... 57 5e-06 >ref|XP_010930369.1| PREDICTED: protein root UVB sensitive 6 [Elaeis guineensis] Length = 514 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -3 Query: 147 IPPTEVKFGPKLVEFA-SESINSKVLCCEEIDGRRWNYVVEMEGSRNL 7 + P E++FGP + A E S+VLCCEE+DGRRWNYVVE+EG L Sbjct: 49 LSPLELRFGPAVEGLAVEEQAPSRVLCCEEVDGRRWNYVVEVEGPGRL 96 >ref|XP_010908139.1| PREDICTED: protein root UVB sensitive 6-like [Elaeis guineensis] Length = 523 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -3 Query: 138 TEVKFGPKLVEFA--SESINSKVLCCEEIDGRRWNYVVEMEGS 16 TEV+FGP + A + + +S++LCCEEIDGRRWNYVV++EG+ Sbjct: 59 TEVRFGPAVDGLAVNAAAASSRILCCEEIDGRRWNYVVDVEGT 101