BLASTX nr result
ID: Ophiopogon21_contig00038331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00038331 (339 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008791153.1| PREDICTED: protection of telomeres protein 1... 71 3e-10 ref|XP_008791152.1| PREDICTED: protection of telomeres protein 1... 71 3e-10 ref|XP_009408094.1| PREDICTED: protection of telomeres protein 1... 64 6e-08 ref|XP_009408093.1| PREDICTED: protection of telomeres protein 1... 64 6e-08 ref|XP_010929396.1| PREDICTED: protection of telomeres protein 1... 61 4e-07 ref|XP_010929394.1| PREDICTED: protection of telomeres protein 1... 61 4e-07 ref|XP_012086281.1| PREDICTED: protection of telomeres protein 1... 59 2e-06 ref|XP_011039144.1| PREDICTED: protection of telomeres protein 1... 58 2e-06 ref|XP_010099743.1| Protection of telomeres protein 1 [Morus not... 58 3e-06 ref|XP_009800141.1| PREDICTED: protection of telomeres protein 1... 57 4e-06 ref|XP_009800140.1| PREDICTED: protection of telomeres protein 1... 57 4e-06 ref|XP_009620674.1| PREDICTED: protection of telomeres protein 1... 57 4e-06 gb|ACJ49158.1| protection of telomeres 1 protein [Lactuca sativa] 56 9e-06 >ref|XP_008791153.1| PREDICTED: protection of telomeres protein 1a-like isoform X2 [Phoenix dactylifera] Length = 447 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/59 (57%), Positives = 41/59 (69%) Frame = -2 Query: 179 PSGGYVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 PS Y YLP+AD IN+ VNLF +SE+ PK+S+GTDY L LK+ DQS PGLSV Sbjct: 23 PSTAYFYLPLADALKMINVKVNLFAAVSEIREPKRSRGTDYVLTLKIRDQSYSAPGLSV 81 >ref|XP_008791152.1| PREDICTED: protection of telomeres protein 1a-like isoform X1 [Phoenix dactylifera] Length = 481 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/59 (57%), Positives = 41/59 (69%) Frame = -2 Query: 179 PSGGYVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 PS Y YLP+AD IN+ VNLF +SE+ PK+S+GTDY L LK+ DQS PGLSV Sbjct: 23 PSTAYFYLPLADALKMINVKVNLFAAVSEIREPKRSRGTDYVLTLKIRDQSYSAPGLSV 81 >ref|XP_009408094.1| PREDICTED: protection of telomeres protein 1a isoform X2 [Musa acuminata subsp. malaccensis] Length = 374 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/59 (50%), Positives = 40/59 (67%) Frame = -2 Query: 179 PSGGYVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 PS VYLPI D + I+ VN+F +S +G KKS+GTDY + LK++DQS PG+SV Sbjct: 6 PSVDSVYLPIRDARKCIHERVNIFAAVSSIGAEKKSRGTDYVVSLKIMDQSYMEPGISV 64 >ref|XP_009408093.1| PREDICTED: protection of telomeres protein 1a isoform X1 [Musa acuminata subsp. malaccensis] Length = 467 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/59 (50%), Positives = 40/59 (67%) Frame = -2 Query: 179 PSGGYVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 PS VYLPI D + I+ VN+F +S +G KKS+GTDY + LK++DQS PG+SV Sbjct: 6 PSVDSVYLPIRDARKCIHERVNIFAAVSSIGAEKKSRGTDYVVSLKIMDQSYMEPGISV 64 >ref|XP_010929396.1| PREDICTED: protection of telomeres protein 1a isoform X2 [Elaeis guineensis] Length = 428 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -2 Query: 167 YVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 Y YLP+ D IN VNLF +SE+ P++S+GTDY L LK+ DQS GLSV Sbjct: 27 YFYLPLTDALKMINAKVNLFASVSEIREPRRSRGTDYVLTLKIRDQSYSALGLSV 81 >ref|XP_010929394.1| PREDICTED: protection of telomeres protein 1a isoform X1 [Elaeis guineensis] Length = 481 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -2 Query: 167 YVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 Y YLP+ D IN VNLF +SE+ P++S+GTDY L LK+ DQS GLSV Sbjct: 27 YFYLPLTDALKMINAKVNLFASVSEIREPRRSRGTDYVLTLKIRDQSYSALGLSV 81 >ref|XP_012086281.1| PREDICTED: protection of telomeres protein 1a-like isoform X1 [Jatropha curcas] gi|643712933|gb|KDP25990.1| hypothetical protein JCGZ_22720 [Jatropha curcas] Length = 473 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = -2 Query: 167 YVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 Y +L I D SIN V+L I E G PKK++GTD+ LK++D+S P PGLSV Sbjct: 7 YKFLQIRDAIASINQKVSLIGAILEFGLPKKTRGTDWCCTLKIIDESYPKPGLSV 61 >ref|XP_011039144.1| PREDICTED: protection of telomeres protein 1b-like [Populus euphratica] Length = 462 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = -2 Query: 167 YVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 Y +L I D +IN VNL + E+GFPK ++GTDY +K+VD+S P PG+SV Sbjct: 7 YRFLKIKDAISAINQKVNLIGVVIELGFPKTTRGTDYFCSVKIVDESYPKPGISV 61 >ref|XP_010099743.1| Protection of telomeres protein 1 [Morus notabilis] gi|587891708|gb|EXB80320.1| Protection of telomeres protein 1 [Morus notabilis] Length = 466 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/55 (56%), Positives = 35/55 (63%) Frame = -2 Query: 167 YVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 Y +L I D SIN V+L I E GFPKK+KGTD LK+VDQS PGLSV Sbjct: 7 YKFLEIRDAIASINQKVSLIGVIIECGFPKKTKGTDCFCTLKIVDQSYQKPGLSV 61 >ref|XP_009800141.1| PREDICTED: protection of telomeres protein 1b-like isoform X2 [Nicotiana sylvestris] Length = 354 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = -2 Query: 167 YVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 Y +L I D + ++N VNL + E G PK+SKGTD +K++D+S P PG+SV Sbjct: 10 YKFLQIVDARAALNQKVNLIGVVIETGLPKQSKGTDCFCTIKIIDESYPSPGISV 64 >ref|XP_009800140.1| PREDICTED: protection of telomeres protein 1b-like isoform X1 [Nicotiana sylvestris] Length = 466 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = -2 Query: 167 YVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 Y +L I D + ++N VNL + E G PK+SKGTD +K++D+S P PG+SV Sbjct: 10 YKFLQIVDARAALNQKVNLIGVVIETGLPKQSKGTDCFCTIKIIDESYPSPGISV 64 >ref|XP_009620674.1| PREDICTED: protection of telomeres protein 1b isoform X2 [Nicotiana tomentosiformis] Length = 466 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = -2 Query: 167 YVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 Y +L I D + ++N VNL + E G PK+SKGTD +K++D+S P PG+SV Sbjct: 10 YKFLQIVDARAALNQKVNLIGVVIETGLPKQSKGTDCFCTIKIIDESYPSPGISV 64 >gb|ACJ49158.1| protection of telomeres 1 protein [Lactuca sativa] Length = 466 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = -2 Query: 176 SGGYVYLPIADGKMSINMSVNLFVKISEVGFPKKSKGTDYALILKVVDQSCPPPGLSV 3 S Y +L I D SIN VNL ++E G PK+SKGTD +++VD+S P G+SV Sbjct: 6 SDDYKFLRIVDATTSINQKVNLIGVVTEAGIPKQSKGTDCCCTIRIVDESNPSSGISV 63