BLASTX nr result
ID: Ophiopogon21_contig00038189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00038189 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQK00602.1| hypothetical protein BRADI_3g50605 [Brachypodium ... 64 4e-08 dbj|BAK04284.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 4e-07 gb|AFW63263.1| hypothetical protein ZEAMMB73_381801 [Zea mays] 56 9e-06 >gb|KQK00602.1| hypothetical protein BRADI_3g50605 [Brachypodium distachyon] Length = 61 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/55 (58%), Positives = 43/55 (78%) Frame = -2 Query: 307 MLILELGIWVIPFTLVVAPWRRLVLLVSNLQQIWESLRRSLAESAAISSRLSRLQ 143 MLIL LGIW++P TL+ AP RRLVLLV+ LQ++ S+ R+ + S A+ SRL+RLQ Sbjct: 1 MLILVLGIWILPVTLIFAPCRRLVLLVAKLQELEASIMRTRSSSPAMWSRLARLQ 55 >dbj|BAK04284.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 62 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -2 Query: 307 MLILELGIWVIPFTLVVAPWRRLVLLVSNLQQIWESLRRSLAESAAISSRLSRLQ 143 +++LELGIW++P + P RRLVLL++NLQQ+ S+ R+ + S A+ SRL RLQ Sbjct: 2 LILLELGIWILPVACIFTPCRRLVLLLANLQQLKASIMRTRSSSPALWSRLERLQ 56 >gb|AFW63263.1| hypothetical protein ZEAMMB73_381801 [Zea mays] Length = 244 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -2 Query: 307 MLILELGIWVIPFTLVVAPWRRLVLLVSNLQQIWESLRRSLAESAAISSRLSRLQ 143 MLIL LG+W+IP TL+ AP RRLVLLV+ LQ++ S+ R + A S ++R+Q Sbjct: 1 MLILALGVWLIPMTLIFAPCRRLVLLVAKLQELRASIMRGRSSYPAAWSLVTRIQ 55