BLASTX nr result
ID: Ophiopogon21_contig00038074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00038074 (409 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010940912.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 >ref|XP_010940912.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Elaeis guineensis] Length = 566 Score = 61.6 bits (148), Expect = 2e-07 Identities = 33/76 (43%), Positives = 47/76 (61%) Frame = -2 Query: 261 LSRLVDRCKTIRQLQQIHSQILTSPNLVPAFTSSLLNRXXXXXXXXXXXXXXXXXXXFDL 82 L+RL+ RC+++R+L+QIH+ I TSP+L P +SLL+R F Sbjct: 34 LARLIHRCQSLRELRQIHAHITTSPHLDPRTAASLLSRLLFFCATSPAGSLPYASALFRR 93 Query: 81 IPSPTLFAYNAVIRAH 34 +PSPTL AYNA+IRA+ Sbjct: 94 LPSPTLSAYNAMIRAY 109