BLASTX nr result
ID: Ophiopogon21_contig00038031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00038031 (349 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010914953.1| PREDICTED: zeaxanthin epoxidase, chloroplast... 68 2e-09 >ref|XP_010914953.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis] Length = 422 Score = 68.2 bits (165), Expect = 2e-09 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 349 LKQGLPLSDNKIFDPSTADPEECGRIQHKNIPFYEHVPTS 230 LKQGLPL DN FDP TA P+EC R+QH+N+P++EH PTS Sbjct: 382 LKQGLPLQDNTAFDPKTASPDECKRLQHRNMPYFEHAPTS 421