BLASTX nr result
ID: Ophiopogon21_contig00038002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00038002 (357 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854128.1| PREDICTED: phosphoacetylglucosamine mutase [... 57 5e-06 >ref|XP_006854128.1| PREDICTED: phosphoacetylglucosamine mutase [Amborella trichopoda] gi|548857797|gb|ERN15595.1| hypothetical protein AMTR_s00048p00161770 [Amborella trichopoda] Length = 555 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -2 Query: 152 KTFNLFPPNCAGIRFS-GTAGFKAEASVLTSMVFRARILAAIRSLKMGAL 6 K+ +LFPP G++FS GTAGF+AE+S+L+S VFR+ ILAA+RSLK G+L Sbjct: 11 KSASLFPPPL-GVKFSYGTAGFRAESSILSSTVFRSGILAAMRSLKTGSL 59