BLASTX nr result
ID: Ophiopogon21_contig00037819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00037819 (637 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX52395.1| Msn4p [Rhizophagus irregularis DAOM 197198w] 69 2e-09 gb|ESA05859.1| hypothetical protein GLOINDRAFT_82623 [Rhizophagu... 69 2e-09 >gb|EXX52395.1| Msn4p [Rhizophagus irregularis DAOM 197198w] Length = 338 Score = 68.9 bits (167), Expect = 2e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 635 SDNLSQHVRVHRPNGKEKNNPARSFSNFTPFLQTY 531 SDNLSQHVRVHRPNGKEKN R+FSNFTPFLQTY Sbjct: 292 SDNLSQHVRVHRPNGKEKNASTRTFSNFTPFLQTY 326 >gb|ESA05859.1| hypothetical protein GLOINDRAFT_82623 [Rhizophagus irregularis DAOM 181602] Length = 104 Score = 68.9 bits (167), Expect = 2e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 635 SDNLSQHVRVHRPNGKEKNNPARSFSNFTPFLQTY 531 SDNLSQHVRVHRPNGKEKN R+FSNFTPFLQTY Sbjct: 58 SDNLSQHVRVHRPNGKEKNASTRTFSNFTPFLQTY 92