BLASTX nr result
ID: Ophiopogon21_contig00037815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00037815 (853 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFD53814.1| hypothetical protein, partial [Trichoderma harzia... 56 2e-08 >gb|AFD53814.1| hypothetical protein, partial [Trichoderma harzianum] Length = 108 Score = 56.2 bits (134), Expect(2) = 2e-08 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 395 GTKTSHHGLNVVGYRRATNAFTKGCNNANWS*SPK 291 GTKTSHHGLN+VGYRRAT A+TK C N N S S K Sbjct: 39 GTKTSHHGLNIVGYRRATYAWTKRCKNVNLSLSQK 73 Score = 30.8 bits (68), Expect(2) = 2e-08 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 270 SEIRLHEKGITSNRE*SHHGESNL 199 SEIRL+E ITSNRE HGE L Sbjct: 83 SEIRLYESVITSNRESPCHGELTL 106