BLASTX nr result
ID: Ophiopogon21_contig00037611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00037611 (373 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008795193.1| PREDICTED: uncharacterized protein LOC103711... 62 2e-07 ref|XP_010916690.1| PREDICTED: uncharacterized protein LOC105041... 59 2e-06 >ref|XP_008795193.1| PREDICTED: uncharacterized protein LOC103711006 [Phoenix dactylifera] Length = 160 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 6/43 (13%) Frame = +2 Query: 11 IDRPP------MRSEEISPSAGRGKQAFRGKVRRYKLLEEVSS 121 +DRP MRSEEISPS+GRG+Q FRGKVRRYKLLEEVSS Sbjct: 118 LDRPAPDATDRMRSEEISPSSGRGRQVFRGKVRRYKLLEEVSS 160 >ref|XP_010916690.1| PREDICTED: uncharacterized protein LOC105041415 [Elaeis guineensis] Length = 160 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 14 DRPPMRSEEISPSAGRGKQAFRGKVRRYKLLEEVSS 121 DR P SEE+SPS+GRG+QAFRGKVRRYKLLEEVSS Sbjct: 127 DRIP--SEELSPSSGRGRQAFRGKVRRYKLLEEVSS 160