BLASTX nr result
ID: Ophiopogon21_contig00037434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00037434 (471 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002466948.1| hypothetical protein SORBIDRAFT_01g017226 [S... 51 3e-06 >ref|XP_002466948.1| hypothetical protein SORBIDRAFT_01g017226 [Sorghum bicolor] gi|241920802|gb|EER93946.1| hypothetical protein SORBIDRAFT_01g017226 [Sorghum bicolor] Length = 451 Score = 51.2 bits (121), Expect(2) = 3e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 435 VTKLTESAERLSIGLDHLSKQVGDFFQIVLTGR 337 ++ +++SAERL +GLD LSK+VGDFFQIVLTGR Sbjct: 398 ISSMSKSAERLRLGLDSLSKRVGDFFQIVLTGR 430 Score = 26.2 bits (56), Expect(2) = 3e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 286 DALLCNLRISD 254 DALLCNLRISD Sbjct: 431 DALLCNLRISD 441