BLASTX nr result
ID: Ophiopogon21_contig00037117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00037117 (622 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009123417.1| 30S ribosomal protein S16 (chloroplast) [Cat... 88 2e-16 gb|ALM87733.1| ribosomal protein S16 (chloroplast) [Polygonatum ... 80 1e-12 ref|YP_009180090.1| ribosomal protein S16 (chloroplast) [Polygon... 80 1e-12 gb|AEX96510.1| ribosomal protein S16 (chloroplast) [Scadoxus cin... 80 1e-12 gb|AEX96508.1| ribosomal protein S16 (chloroplast) [Crinum asiat... 80 1e-12 gb|AEX96507.1| ribosomal protein S16 (chloroplast) [Amaryllis be... 80 1e-12 ref|YP_009059501.1| ribosomal protein S16 [Iris gatesii] gi|6851... 78 3e-12 gb|AEX96505.1| ribosomal protein S16 (chloroplast) [Gilliesia gr... 78 3e-12 gb|AEX96497.1| ribosomal protein S16 (chloroplast) [Agapanthus a... 78 3e-12 ref|YP_009172259.1| ribosomal protein S16 (chloroplast) [Coloban... 78 5e-12 ref|YP_005089559.1| rps16 gene product (chloroplast) [Silene lat... 78 5e-12 gb|AJP62091.1| ribosomal protein S16 (chloroplast) [Dianthus lon... 78 5e-12 gb|AHY80523.1| ribosomal protein S16 [Beta vulgaris subsp. vulga... 78 5e-12 gb|ADD30042.1| ribosomal protein S16 (chloroplast) [Gunnera mani... 78 5e-12 ref|YP_009000078.1| ribosomal protein S16 (chloroplast) (chlorop... 78 5e-12 gb|AEX96509.1| ribosomal protein S16 (chloroplast) [Eucharis x g... 78 5e-12 ref|YP_005089316.1| rps16 gene product (chloroplast) [Silene vul... 78 5e-12 ref|YP_005089397.1| rps16 gene product (chloroplast) [Silene noc... 78 5e-12 ref|YP_005089478.1| rps16 gene product (chloroplast) [Silene con... 78 5e-12 ref|YP_784455.1| ribosomal protein S16 [Piper cenocladum] gi|937... 78 5e-12 >ref|YP_009123417.1| 30S ribosomal protein S16 (chloroplast) [Cattleya crispata] gi|756762299|gb|AJM70390.1| 30S ribosomal protein S16 (chloroplast) [Cattleya crispata] Length = 100 Score = 87.8 bits (216), Expect(2) = 2e-16 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -2 Query: 147 GGIIYLHLSQ*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 GGI YLHLSQ AIYRIVAIDVRSRREGRDL+KVGFYDPI+NQTY NV A Sbjct: 10 GGIFYLHLSQWAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYSNVSA 58 Score = 25.0 bits (53), Expect(2) = 2e-16 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 178 MRRKPPIRF*GGYYLSTS 125 MRRK PIRF G +YL S Sbjct: 1 MRRKLPIRFGGIFYLHLS 18 >gb|ALM87733.1| ribosomal protein S16 (chloroplast) [Polygonatum verticillatum] Length = 84 Score = 79.7 bits (195), Expect = 1e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 52 >ref|YP_009180090.1| ribosomal protein S16 (chloroplast) [Polygonatum cyrtonema] gi|944543301|gb|ALL96491.1| ribosomal protein S16 (chloroplast) [Polygonatum cyrtonema] Length = 83 Score = 79.7 bits (195), Expect = 1e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 52 >gb|AEX96510.1| ribosomal protein S16 (chloroplast) [Scadoxus cinnabarinus] Length = 82 Score = 79.7 bits (195), Expect = 1e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 52 >gb|AEX96508.1| ribosomal protein S16 (chloroplast) [Crinum asiaticum] Length = 82 Score = 79.7 bits (195), Expect = 1e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 52 >gb|AEX96507.1| ribosomal protein S16 (chloroplast) [Amaryllis belladonna] Length = 82 Score = 79.7 bits (195), Expect = 1e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 52 >ref|YP_009059501.1| ribosomal protein S16 [Iris gatesii] gi|685161379|gb|AIN79023.1| ribosomal protein S16 [Iris gatesii] Length = 83 Score = 78.2 bits (191), Expect = 3e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDL+KVGFYDPIQNQTYLNVPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLRKVGFYDPIQNQTYLNVPA 52 >gb|AEX96505.1| ribosomal protein S16 (chloroplast) [Gilliesia graminea] Length = 81 Score = 78.2 bits (191), Expect = 3e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDL+KVGFYDPIQNQTYLNVPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLRKVGFYDPIQNQTYLNVPA 52 >gb|AEX96497.1| ribosomal protein S16 (chloroplast) [Agapanthus africanus] Length = 78 Score = 78.2 bits (191), Expect = 3e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDL+KVGFYDPIQNQTYLNVPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLRKVGFYDPIQNQTYLNVPA 52 >ref|YP_009172259.1| ribosomal protein S16 (chloroplast) [Colobanthus quitensis] gi|930616910|gb|ALF99647.1| ribosomal protein S16 (chloroplast) [Colobanthus quitensis] Length = 80 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >ref|YP_005089559.1| rps16 gene product (chloroplast) [Silene latifolia] gi|68053015|sp|Q589B0.1|RR16_SILLA RecName: Full=30S ribosomal protein S16, chloroplastic gi|62149325|dbj|BAD93467.1| ribosomal protein S16 [Silene latifolia] gi|329755503|gb|AEC04066.1| ribosomal protein S16 (chloroplast) [Silene latifolia] Length = 88 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >gb|AJP62091.1| ribosomal protein S16 (chloroplast) [Dianthus longicalyx] Length = 88 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >gb|AHY80523.1| ribosomal protein S16 [Beta vulgaris subsp. vulgaris] Length = 88 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >gb|ADD30042.1| ribosomal protein S16 (chloroplast) [Gunnera manicata] Length = 88 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >ref|YP_009000078.1| ribosomal protein S16 (chloroplast) (chloroplast) [Silene chalcedonica] gi|555944166|gb|AGZ18068.1| ribosomal protein S16 (chloroplast) [Silene chalcedonica] Length = 88 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >gb|AEX96509.1| ribosomal protein S16 (chloroplast) [Eucharis x grandiflora] Length = 82 Score = 77.8 bits (190), Expect = 5e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYL+VPA Sbjct: 13 QRAIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLDVPA 52 >ref|YP_005089316.1| rps16 gene product (chloroplast) [Silene vulgaris] gi|575925612|ref|YP_008999997.1| ribosomal protein S16 (chloroplast) (chloroplast) [Silene conoidea] gi|329755668|gb|AEC04229.1| ribosomal protein S16 (chloroplast) [Silene vulgaris] gi|555944084|gb|AGZ17987.1| ribosomal protein S16 (chloroplast) [Silene conoidea] gi|916444174|gb|AKZ24356.1| ribosomal protein S16 (plastid) [Silene vulgaris] Length = 88 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >ref|YP_005089397.1| rps16 gene product (chloroplast) [Silene noctiflora] gi|329755585|gb|AEC04147.1| ribosomal protein S16 (chloroplast) [Silene noctiflora] Length = 88 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >ref|YP_005089478.1| rps16 gene product (chloroplast) [Silene conica] gi|329755421|gb|AEC03985.1| ribosomal protein S16 (chloroplast) [Silene conica] Length = 82 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52 >ref|YP_784455.1| ribosomal protein S16 [Piper cenocladum] gi|937408038|ref|YP_009166207.1| ribosomal protein S16 (chloroplast) [Piper kadsura] gi|122164380|sp|Q06GS8.1|RR16_PIPCE RecName: Full=30S ribosomal protein S16, chloroplastic gi|112253733|gb|ABI14454.1| ribosomal protein S16 [Piper cenocladum] gi|918056550|gb|AKZ89434.1| ribosomal protein S16 (chloroplast) [Piper kadsura] Length = 97 Score = 77.8 bits (190), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 Q*AIYRIVAIDVRSRREGRDLQKVGFYDPIQNQTYLNVPA 1 Q A+YRIVAIDVRSRREGRDLQKVGFYDPI+NQTYLNVPA Sbjct: 13 QRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPA 52