BLASTX nr result
ID: Ophiopogon21_contig00037080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00037080 (327 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006374141.1| hypothetical protein POPTR_0015s02570g [Popu... 64 3e-08 ref|XP_010111387.1| hypothetical protein L484_028044 [Morus nota... 61 4e-07 gb|AEX57692.1| hypothetical protein RasatMp061 (mitochondrion) [... 56 9e-06 >ref|XP_006374141.1| hypothetical protein POPTR_0015s02570g [Populus trichocarpa] gi|550321813|gb|ERP51938.1| hypothetical protein POPTR_0015s02570g [Populus trichocarpa] Length = 70 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -3 Query: 145 PSPGISLYNFRIKDATVLTLSLVSRSGVPSSLALRPRYSVSCF 17 P+PGI LY+FR D ++T SLVSRSGVPSSLALRPRYS S F Sbjct: 22 PNPGIDLYHFRRNDIKLITFSLVSRSGVPSSLALRPRYSFSSF 64 >ref|XP_010111387.1| hypothetical protein L484_028044 [Morus notabilis] gi|587944383|gb|EXC30865.1| hypothetical protein L484_028044 [Morus notabilis] Length = 110 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +1 Query: 166 KTFADATMNQTRSKHSAVDGQTSSRTSTGMGWPGPGSQG 282 KTFAD TMN+TRSK S DGQT S+ GWPGPGSQG Sbjct: 72 KTFADVTMNRTRSKQSTADGQTLSKCRANEGWPGPGSQG 110 >gb|AEX57692.1| hypothetical protein RasatMp061 (mitochondrion) [Raphanus sativus] Length = 126 Score = 56.2 bits (134), Expect = 9e-06 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 4/59 (6%) Frame = +1 Query: 157 PPGKTFADATMNQTRSKHSAVDGQT----SSRTSTGMGWPGPGSQGVRVFPMLSLLRSE 321 P GKTFADA MN+TRSKHSAVDGQT +T G P P V VFP++SLL+SE Sbjct: 51 PHGKTFADAIMNRTRSKHSAVDGQTLPKRRPQTKDGQA-PVP---RVIVFPIMSLLKSE 105