BLASTX nr result
ID: Ophiopogon21_contig00035937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00035937 (511 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS52339.1| hypothetical protein TRIUR3_09913 [Triticum urartu] 57 5e-06 >gb|EMS52339.1| hypothetical protein TRIUR3_09913 [Triticum urartu] Length = 149 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = -3 Query: 380 GGEMNRNLSGLLIGLVGAGFTVCAYSQTIMSTTQCXXXXXXXXXXXXXVKEGFLS 216 GG M+RN++GLL+G VGA TV AY QT++S+TQC +KEGF S Sbjct: 94 GGSMDRNMTGLLLGCVGAAMTVLAYQQTVVSSTQCIGAGLAVLVCALCIKEGFFS 148