BLASTX nr result
ID: Ophiopogon21_contig00035909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00035909 (397 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97800.1| unnamed protein product [Coffea canephora] 57 5e-06 ref|XP_008800474.1| PREDICTED: AT-rich interactive domain-contai... 57 7e-06 gb|EPS64738.1| hypothetical protein M569_10043, partial [Genlise... 57 7e-06 ref|XP_011072682.1| PREDICTED: AT-rich interactive domain-contai... 56 9e-06 >emb|CDO97800.1| unnamed protein product [Coffea canephora] Length = 772 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +2 Query: 2 YDCDRRRGLASFKAYAKVDGLEYICPQCS*LWLKNKLDES 121 + CDRR+GL +FK YAK DGLEYICPQCS K K+ ++ Sbjct: 729 FGCDRRQGLGAFKDYAKTDGLEYICPQCSVSTFKKKMQKT 768 >ref|XP_008800474.1| PREDICTED: AT-rich interactive domain-containing protein 4-like isoform X2 [Phoenix dactylifera] Length = 784 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +2 Query: 2 YDCDRRRGLASFKAYAKVDGLEYICPQCS*LWLKNKLDESACKFP 136 + CDRR+GL +FK YAK DGLEYICP CS K K + A FP Sbjct: 731 FGCDRRQGLGAFKDYAKTDGLEYICPHCSFTNFKRKSQKVANGFP 775 >gb|EPS64738.1| hypothetical protein M569_10043, partial [Genlisea aurea] Length = 182 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +2 Query: 2 YDCDRRRGLASFKAYAKVDGLEYICPQCS*LWLKNKLDESA 124 + CDRR GL +FK YAK DGLEYICPQCS K K+ +A Sbjct: 133 FGCDRRPGLGAFKDYAKTDGLEYICPQCSTTSYKKKMQRTA 173 >ref|XP_011072682.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Sesamum indicum] Length = 773 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +2 Query: 2 YDCDRRRGLASFKAYAKVDGLEYICPQCS*LWLKNKLDES 121 + CDRR GL +FK YAK DGLEYICPQCS K K+++S Sbjct: 729 FGCDRRPGLGAFKDYAKTDGLEYICPQCSVSNYKKKMNKS 768