BLASTX nr result
ID: Ophiopogon21_contig00035672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00035672 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CRG90468.1| Translational activator gcn1 [Talaromyces island... 63 1e-07 gb|EEH22435.2| hypothetical protein PABG_04646 [Paracoccidioides... 62 2e-07 gb|KGQ00757.1| hypothetical protein PAAG_12568 [Paracoccidioides... 62 2e-07 ref|XP_010761127.1| hypothetical protein PADG_11904 [Paracoccidi... 62 2e-07 ref|XP_002789572.1| 60S ribosomal protein L19 [Paracoccidioides ... 62 2e-07 gb|KMQ42599.1| Ribosomal protein L19/L19e domain [Trichophyton r... 61 4e-07 gb|KKY26580.1| putative 60s ribosomal protein l19 [Diplodia seri... 61 4e-07 dbj|GAM35606.1| translation elongation regulator [Talaromyces ce... 61 4e-07 gb|KFX47463.1| Translational activator GCN1 [Talaromyces marneff... 61 4e-07 ref|XP_013264226.1| large subunit ribosomal protein L19e [Exophi... 61 4e-07 ref|XP_003025048.1| hypothetical protein TRV_00786 [Trichophyton... 61 4e-07 ref|XP_003013989.1| hypothetical protein ARB_07709 [Arthroderma ... 61 4e-07 ref|XP_002146490.1| translational activator GCN1 [Talaromyces ma... 61 4e-07 gb|EZF69311.1| hypothetical protein H105_08157 [Trichophyton sou... 61 4e-07 gb|EZF33535.1| hypothetical protein H101_02897 [Trichophyton int... 61 4e-07 ref|XP_007755694.1| large subunit ribosomal protein L19e [Cladop... 61 4e-07 ref|XP_008727456.1| hypothetical protein G647_04897 [Cladophialo... 61 4e-07 gb|EGE03654.1| 60S ribosomal protein L19 [Trichophyton equinum C... 61 4e-07 gb|EGD94736.1| 60S ribosomal protein L19 [Trichophyton tonsurans... 61 4e-07 ref|XP_003238733.1| 60S ribosomal protein L19 [Trichophyton rubr... 61 4e-07 >emb|CRG90468.1| Translational activator gcn1 [Talaromyces islandicus] Length = 2883 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+TLKEEMD Sbjct: 2821 TFKHKRALVEHIHKAKAEKQRERTLKEEMD 2850 >gb|EEH22435.2| hypothetical protein PABG_04646 [Paracoccidioides brasiliensis Pb03] Length = 2873 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+T+KEEMD Sbjct: 2813 TFKHKRALVEHIHKAKAEKQRERTIKEEMD 2842 >gb|KGQ00757.1| hypothetical protein PAAG_12568 [Paracoccidioides lutzii Pb01] Length = 2890 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+T+KEEMD Sbjct: 2830 TFKHKRALVEHIHKAKAEKQRERTIKEEMD 2859 >ref|XP_010761127.1| hypothetical protein PADG_11904 [Paracoccidioides brasiliensis Pb18] gi|699749792|gb|KGM91931.1| hypothetical protein PADG_11904 [Paracoccidioides brasiliensis Pb18] Length = 2873 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+T+KEEMD Sbjct: 2813 TFKHKRALVEHIHKAKAEKQRERTIKEEMD 2842 >ref|XP_002789572.1| 60S ribosomal protein L19 [Paracoccidioides lutzii Pb01] Length = 191 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+T+KEEMD Sbjct: 131 TFKHKRALVEHIHKAKAEKQRERTIKEEMD 160 >gb|KMQ42599.1| Ribosomal protein L19/L19e domain [Trichophyton rubrum] Length = 206 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 145 TFKHKRALVEHIHKAKAEKQRERALKEEMD 174 >gb|KKY26580.1| putative 60s ribosomal protein l19 [Diplodia seriata] Length = 183 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 126 TFKHKRALVEHIHKAKAEKQRERVLKEEMD 155 >dbj|GAM35606.1| translation elongation regulator [Talaromyces cellulolyticus] Length = 2807 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 2746 TFKHKRALVEHIHKAKAEKQRERVLKEEMD 2775 >gb|KFX47463.1| Translational activator GCN1 [Talaromyces marneffei PM1] Length = 2849 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 2788 TFKHKRALVEHIHKAKAEKQRERVLKEEMD 2817 >ref|XP_013264226.1| large subunit ribosomal protein L19e [Exophiala aquamarina CBS 119918] gi|656916057|gb|KEF61636.1| large subunit ribosomal protein L19e [Exophiala aquamarina CBS 119918] Length = 202 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 139 TFKHKRALVEHIHKAKAEKQRERVLKEEMD 168 >ref|XP_003025048.1| hypothetical protein TRV_00786 [Trichophyton verrucosum HKI 0517] gi|291189129|gb|EFE44437.1| hypothetical protein TRV_00786 [Trichophyton verrucosum HKI 0517] Length = 214 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 153 TFKHKRALVEHIHKAKAEKQRERALKEEMD 182 >ref|XP_003013989.1| hypothetical protein ARB_07709 [Arthroderma benhamiae CBS 112371] gi|291177556|gb|EFE33349.1| hypothetical protein ARB_07709 [Arthroderma benhamiae CBS 112371] Length = 228 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 167 TFKHKRALVEHIHKAKAEKQRERALKEEMD 196 >ref|XP_002146490.1| translational activator GCN1 [Talaromyces marneffei ATCC 18224] gi|210071854|gb|EEA25943.1| translational activator, putative [Talaromyces marneffei ATCC 18224] Length = 2863 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 2802 TFKHKRALVEHIHKAKAEKQRERVLKEEMD 2831 >gb|EZF69311.1| hypothetical protein H105_08157 [Trichophyton soudanense CBS 452.61] Length = 193 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 132 TFKHKRALVEHIHKAKAEKQRERALKEEMD 161 >gb|EZF33535.1| hypothetical protein H101_02897 [Trichophyton interdigitale H6] gi|633045521|gb|KDB22317.1| hypothetical protein H109_05764 [Trichophyton interdigitale MR816] Length = 192 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 131 TFKHKRALVEHIHKAKAEKQRERALKEEMD 160 >ref|XP_007755694.1| large subunit ribosomal protein L19e [Cladophialophora yegresii CBS 114405] gi|589979770|gb|EXJ63040.1| large subunit ribosomal protein L19e [Cladophialophora yegresii CBS 114405] Length = 126 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 62 TFKHKRALVEHIHKAKAEKQRERVLKEEMD 91 >ref|XP_008727456.1| hypothetical protein G647_04897 [Cladophialophora carrionii CBS 160.54] gi|565933847|gb|ETI23101.1| hypothetical protein G647_04897 [Cladophialophora carrionii CBS 160.54] Length = 126 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 62 TFKHKRALVEHIHKAKAEKQRERVLKEEMD 91 >gb|EGE03654.1| 60S ribosomal protein L19 [Trichophyton equinum CBS 127.97] Length = 197 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 137 TFKHKRALVEHIHKAKAEKQRERALKEEMD 166 >gb|EGD94736.1| 60S ribosomal protein L19 [Trichophyton tonsurans CBS 112818] Length = 198 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 137 TFKHKRALVEHIHKAKAEKQRERALKEEMD 166 >ref|XP_003238733.1| 60S ribosomal protein L19 [Trichophyton rubrum CBS 118892] gi|326458989|gb|EGD84442.1| hypothetical protein TERG_00720 [Trichophyton rubrum CBS 118892] gi|607865177|gb|EZF10615.1| hypothetical protein H100_08173 [Trichophyton rubrum MR850] gi|607899721|gb|EZF37487.1| hypothetical protein H102_08130 [Trichophyton rubrum CBS 100081] gi|607911779|gb|EZF48053.1| hypothetical protein H103_08156 [Trichophyton rubrum CBS 288.86] gi|607923952|gb|EZF58778.1| hypothetical protein H104_08105 [Trichophyton rubrum CBS 289.86] gi|607947842|gb|EZF80033.1| hypothetical protein H110_08159 [Trichophyton rubrum MR1448] gi|607959921|gb|EZF90647.1| hypothetical protein H113_08221 [Trichophyton rubrum MR1459] gi|607972687|gb|EZG02008.1| hypothetical protein H106_08028 [Trichophyton rubrum CBS 735.88] gi|607983992|gb|EZG12287.1| hypothetical protein H107_08298 [Trichophyton rubrum CBS 202.88] gi|633053886|gb|KDB29182.1| hypothetical protein H112_08146 [Trichophyton rubrum D6] Length = 193 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 325 TFKHKRALVEHIHKAKAEKQREKTLKEEMD 236 TFKHKRALVEHIHKAKAEKQRE+ LKEEMD Sbjct: 132 TFKHKRALVEHIHKAKAEKQRERALKEEMD 161