BLASTX nr result
ID: Ophiopogon21_contig00035380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00035380 (471 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008807812.1| PREDICTED: uncharacterized protein LOC103720... 57 7e-06 >ref|XP_008807812.1| PREDICTED: uncharacterized protein LOC103720062 [Phoenix dactylifera] Length = 863 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -1 Query: 264 SWIHLTCEYVVEERCSYCSTPVPFESERFARCEGIKHQNGSIDKHEL 124 S IH CEY +EE CS+C VPFESE A C+G K +GS + H L Sbjct: 735 SRIHSVCEYTMEESCSFCLASVPFESEEVAWCKGSKSDDGSKESHRL 781