BLASTX nr result
ID: Ophiopogon21_contig00035305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00035305 (339 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011028551.1| PREDICTED: triose phosphate/phosphate transl... 56 9e-06 >ref|XP_011028551.1| PREDICTED: triose phosphate/phosphate translocator, non-green plastid, chloroplastic-like [Populus euphratica] Length = 416 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/56 (42%), Positives = 39/56 (69%) Frame = +3 Query: 108 PLLSPLPSDREDIARSAAGESSDEKADRSIMLQMLQFGAIFGLWYLLNIYISIYNK 275 PL+S ++R ++ +A ES+ E ++S +++ L+ G +FGLWYL NIY +IYNK Sbjct: 80 PLVSESKTERFEVRATAVPESAGEGKEKSSLVKTLELGLLFGLWYLFNIYFNIYNK 135