BLASTX nr result
ID: Ophiopogon21_contig00035167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00035167 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008800307.1| PREDICTED: uncharacterized protein LOC103714... 64 4e-08 ref|XP_009410746.1| PREDICTED: uncharacterized protein LOC103992... 58 2e-06 >ref|XP_008800307.1| PREDICTED: uncharacterized protein LOC103714712 [Phoenix dactylifera] Length = 85 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 205 SYLAYPDVYGKMKSTLSCWMARLPAGPSPKGPGH 104 SYL YP+VY K KST++CWMA+L AGPSPKGPGH Sbjct: 52 SYLVYPNVYEKAKSTMACWMAKLAAGPSPKGPGH 85 >ref|XP_009410746.1| PREDICTED: uncharacterized protein LOC103992672 [Musa acuminata subsp. malaccensis] Length = 74 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -1 Query: 217 DXXXSYLAYPDVYGKMKSTLSCWMARLPAGPSPKGPGH 104 D SYLAYP K ++T++ WMARLP+GPSPKGPGH Sbjct: 37 DGGESYLAYPSTQEKARATVATWMARLPSGPSPKGPGH 74