BLASTX nr result
ID: Ophiopogon21_contig00035058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00035058 (1436 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA06587.1| hypothetical protein GLOINDRAFT_349769, partial [... 140 2e-30 >gb|ESA06587.1| hypothetical protein GLOINDRAFT_349769, partial [Rhizophagus irregularis DAOM 181602] Length = 114 Score = 140 bits (354), Expect = 2e-30 Identities = 68/71 (95%), Positives = 70/71 (98%) Frame = -3 Query: 1434 PDLDDFAQQCRLLTRALILPFLHATHSFMSESLQTTNNIQSPRSVTSTTRTFMNLMYWTF 1255 PDLDDFAQQCRLLTRALILPFLHATHSFMSESLQTT NIQ+P+SVTSTTRTFMNLMYWTF Sbjct: 44 PDLDDFAQQCRLLTRALILPFLHATHSFMSESLQTTTNIQTPKSVTSTTRTFMNLMYWTF 103 Query: 1254 LFTLGSLVLDA 1222 LFTLGSLVLDA Sbjct: 104 LFTLGSLVLDA 114