BLASTX nr result
ID: Ophiopogon21_contig00034867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00034867 (320 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010912918.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_009415073.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_008808163.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008808162.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_010912918.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Elaeis guineensis] Length = 738 Score = 62.0 bits (149), Expect = 2e-07 Identities = 35/80 (43%), Positives = 51/80 (63%), Gaps = 2/80 (2%) Frame = +3 Query: 87 PIRAFFRFRSHTQPDPEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSEA 266 PI FF+ RS TQ DP++EGR + QRNRR+SW IA+ E+D +E +D +A S++ Sbjct: 118 PILNFFKSRSETQ-DPKREGRLTLQRNRRSSWHIADFESDDLEEEEEEEDVQAVELDSDS 176 Query: 267 SV--DTGSDSVVEEILRVSR 320 V T D VV +I+ ++R Sbjct: 177 GVPEPTSEDGVVGKIMGIAR 196 >ref|XP_009415073.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Musa acuminata subsp. malaccensis] Length = 734 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%) Frame = +3 Query: 87 PIRAFFRFRSHTQPD-PEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSE 263 PI FFRFRS + D P+Q+GR S QRNRRTSW IA I++ ++ D+ + S Sbjct: 115 PILEFFRFRSSSSADDPKQDGRLSLQRNRRTSWHIANIDSADLDHDGLEDEGQVLEPPSP 174 Query: 264 ASVDTGSDSVVEEILRVSR 320 + D VV EIL V+R Sbjct: 175 SPPQPAEDGVVAEILGVAR 193 >ref|XP_008808163.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X2 [Phoenix dactylifera] Length = 744 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 6/84 (7%) Frame = +3 Query: 87 PIRAFFRFRSHTQPDPEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSEA 266 PIR FF+ RS T+ DP++EGR + QRNRR++W IA++++D +E ++ E E+ + E Sbjct: 121 PIRNFFKSRSETR-DPKREGRLTLQRNRRSTWHIADLQSDDIEEEE-EEEEEEEVQAVEP 178 Query: 267 SVDTG------SDSVVEEILRVSR 320 D+G D VV +I+ ++R Sbjct: 179 DSDSGVPEPASEDGVVGKIMGIAR 202 >ref|XP_008808162.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X1 [Phoenix dactylifera] Length = 756 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 6/84 (7%) Frame = +3 Query: 87 PIRAFFRFRSHTQPDPEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSEA 266 PIR FF+ RS T+ DP++EGR + QRNRR++W IA++++D +E ++ E E+ + E Sbjct: 121 PIRNFFKSRSETR-DPKREGRLTLQRNRRSTWHIADLQSDDIEEEE-EEEEEEEVQAVEP 178 Query: 267 SVDTG------SDSVVEEILRVSR 320 D+G D VV +I+ ++R Sbjct: 179 DSDSGVPEPASEDGVVGKIMGIAR 202