BLASTX nr result
ID: Ophiopogon21_contig00034820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00034820 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010026605.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 66 1e-08 gb|KCW59708.1| hypothetical protein EUGRSUZ_H02468 [Eucalyptus g... 66 1e-08 ref|XP_007017443.1| F-box/RNI-like superfamily protein isoform 2... 62 1e-07 ref|XP_007017442.1| F-box/RNI-like superfamily protein isoform 1... 62 1e-07 ref|XP_010025397.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 62 2e-07 ref|XP_010025318.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 62 2e-07 ref|XP_010025260.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 62 2e-07 gb|KCW88057.1| hypothetical protein EUGRSUZ_A00479 [Eucalyptus g... 62 2e-07 gb|KCW88055.1| hypothetical protein EUGRSUZ_A00477 [Eucalyptus g... 62 2e-07 ref|XP_009765509.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 61 4e-07 gb|EMT10750.1| hypothetical protein F775_18436 [Aegilops tauschii] 61 4e-07 ref|XP_002459651.1| hypothetical protein SORBIDRAFT_02g008030 [S... 61 4e-07 ref|XP_009776188.1| PREDICTED: uncharacterized protein LOC104226... 60 5e-07 ref|XP_009773180.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 60 5e-07 ref|XP_006348777.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 60 5e-07 ref|XP_010446083.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 60 6e-07 ref|XP_010442775.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 60 6e-07 ref|XP_010473855.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 60 6e-07 ref|XP_007045674.1| F-box/RNI-like superfamily protein [Theobrom... 60 6e-07 ref|XP_009759006.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 60 8e-07 >ref|XP_010026605.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Eucalyptus grandis] Length = 330 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -1 Query: 132 LSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 +S+LP+++ +EILSRLP K AGRT+VLSR WRH+WRSIP L Sbjct: 15 ISELPKHIAEEILSRLPIKQAGRTSVLSRKWRHKWRSIPRL 55 >gb|KCW59708.1| hypothetical protein EUGRSUZ_H02468 [Eucalyptus grandis] Length = 385 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -1 Query: 132 LSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 +S+LP+++ +EILSRLP K AGRT+VLSR WRH+WRSIP L Sbjct: 8 ISELPKHIAEEILSRLPIKQAGRTSVLSRKWRHKWRSIPRL 48 >ref|XP_007017443.1| F-box/RNI-like superfamily protein isoform 2 [Theobroma cacao] gi|508722771|gb|EOY14668.1| F-box/RNI-like superfamily protein isoform 2 [Theobroma cacao] Length = 347 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/63 (50%), Positives = 43/63 (68%) Frame = -1 Query: 198 SILTLASEKLRKKEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSI 19 SI+T E LR + L +S+LP +VID+ILS LP +DA RT+VLSR WR++W +I Sbjct: 2 SIVTKQREPLRLPIKTEAELDKISNLPGHVIDQILSHLPIRDAVRTSVLSRKWRYKWATI 61 Query: 18 PDL 10 P L Sbjct: 62 PYL 64 >ref|XP_007017442.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|508722770|gb|EOY14667.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] Length = 432 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/63 (50%), Positives = 43/63 (68%) Frame = -1 Query: 198 SILTLASEKLRKKEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSI 19 SI+T E LR + L +S+LP +VID+ILS LP +DA RT+VLSR WR++W +I Sbjct: 2 SIVTKQREPLRLPIKTEAELDKISNLPGHVIDQILSHLPIRDAVRTSVLSRKWRYKWATI 61 Query: 18 PDL 10 P L Sbjct: 62 PYL 64 >ref|XP_010025397.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X3 [Eucalyptus grandis] Length = 386 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = -1 Query: 150 MGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 M L +S+LP +++D+ILSRLP KDA RT++LSR WR++W S+P L Sbjct: 22 MNELDKISELPGHIMDQILSRLPIKDAVRTSILSRKWRYKWSSVPQL 68 >ref|XP_010025318.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Eucalyptus grandis] Length = 419 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = -1 Query: 150 MGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 M L +S+LP +++D+ILSRLP KDA RT++LSR WR++W S+P L Sbjct: 2 MNELDKISELPGHIMDQILSRLPIKDAVRTSILSRKWRYKWSSVPQL 48 >ref|XP_010025260.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Eucalyptus grandis] Length = 437 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = -1 Query: 150 MGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 M L +S+LP +++D+ILSRLP KDA RT++LSR WR++W S+P L Sbjct: 22 MNELDKISELPGHIMDQILSRLPIKDAVRTSILSRKWRYKWSSVPQL 68 >gb|KCW88057.1| hypothetical protein EUGRSUZ_A00479 [Eucalyptus grandis] Length = 357 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = -1 Query: 150 MGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 M L +S+LP +++D+ILSRLP KDA RT++LSR WR++W S+P L Sbjct: 2 MNELDKISELPGHIMDQILSRLPIKDAVRTSILSRKWRYKWSSVPQL 48 >gb|KCW88055.1| hypothetical protein EUGRSUZ_A00477 [Eucalyptus grandis] Length = 348 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = -1 Query: 150 MGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 M L +S LP +++D+ILSRLP KDA RT++LSR WR+RW S+P L Sbjct: 2 MNELDKISKLPGHIMDQILSRLPIKDAVRTSILSRKWRYRWSSVPQL 48 >ref|XP_009765509.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana sylvestris] Length = 201 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/51 (50%), Positives = 38/51 (74%) Frame = -1 Query: 162 KEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 K + + PL LS+LP++VID+IL RLP +DA RT++LS+ WR+ W +P L Sbjct: 7 KRQHLPPLKVLSNLPDSVIDDILMRLPLRDAVRTSILSKKWRYNWCRLPQL 57 >gb|EMT10750.1| hypothetical protein F775_18436 [Aegilops tauschii] Length = 457 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = -1 Query: 168 RKKEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDLDL 4 R KE + +L LP + +D IL RL +DA RT+VLSR+WRHRW ++P LDL Sbjct: 24 RVKEAALAEADALISLPPDAVDSILVRLDIRDAVRTSVLSRTWRHRWEALPSLDL 78 >ref|XP_002459651.1| hypothetical protein SORBIDRAFT_02g008030 [Sorghum bicolor] gi|241923028|gb|EER96172.1| hypothetical protein SORBIDRAFT_02g008030 [Sorghum bicolor] Length = 476 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 2/66 (3%) Frame = -1 Query: 195 ILTLASEK-LRKKEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSI 19 +LT A ++ L ++EE++ +S LP++V+ +I+S LPTKD RT VLS WRH WRS Sbjct: 3 MLTRAKKRRLEQEEERLAVADRISSLPDDVLGDIVSLLPTKDGARTQVLSSRWRHVWRSA 62 Query: 18 P-DLDL 4 P +LDL Sbjct: 63 PLNLDL 68 >ref|XP_009776188.1| PREDICTED: uncharacterized protein LOC104226000, partial [Nicotiana sylvestris] Length = 690 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/59 (47%), Positives = 40/59 (67%) Frame = -1 Query: 180 SEKLRKKEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDLDL 4 S K K+ + PL L LPEN+ID+IL LP +D RT++LS+ WR+ WR++P+L L Sbjct: 429 SPKGVKRGCQTAPLDILCSLPENLIDDILMHLPLRDVVRTSILSKKWRYNWRNLPELTL 487 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = -1 Query: 186 LASEKLRKKEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDLD 7 + S K +K + L LS+LP N+IDEIL RLP +DA RT++LS+ WR+ W +P+L Sbjct: 143 MMSLKDKKLSSQRVSLDILSNLPGNLIDEILIRLPLQDAVRTSILSKKWRYNWCRLPELT 202 Query: 6 LS 1 L+ Sbjct: 203 LN 204 >ref|XP_009773180.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana sylvestris] gi|698565145|ref|XP_009773181.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana sylvestris] Length = 433 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -1 Query: 144 PLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDLDL 4 PL LS LPENVID+IL RLP +D RT++LS+ WR+ W +P+L L Sbjct: 16 PLDMLSSLPENVIDDILLRLPLRDVVRTSILSKKWRYNWCRLPELAL 62 >ref|XP_006348777.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum tuberosum] Length = 110 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -1 Query: 144 PLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDLDLS 1 PL LS LP+NVIDEIL LP ++A RT++LS WR++W IPDL L+ Sbjct: 11 PLDVLSSLPDNVIDEILMCLPLREAVRTSILSTKWRYKWCKIPDLKLN 58 >ref|XP_010446083.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g51370-like [Camelina sativa] Length = 443 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -1 Query: 174 KLRKKEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDLDLS 1 K+R+KE + L +S+LP+ I EIL RL TKDA RT+VLS WR+ W+S+P LDLS Sbjct: 9 KIREKESQEEDL--ISNLPDRWICEILLRLSTKDAVRTSVLSTRWRYLWQSVPGLDLS 64 >ref|XP_010442775.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g51370-like [Camelina sativa] Length = 457 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = -1 Query: 192 LTLASEKLRKKEEKMGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPD 13 + + +K + K + G LS LPE +I EIL RL TKDA RT++LS WR+ WR +PD Sbjct: 1 MVVGRQKKKTKTCEHGKEDLLSQLPEPLISEILCRLSTKDAVRTSLLSTRWRNLWRWVPD 60 Query: 12 LDL 4 LDL Sbjct: 61 LDL 63 >ref|XP_010473855.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g51370-like [Camelina sativa] Length = 453 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 132 LSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDLDLS 1 +S LPE +I EIL RL TKDA RT++LS SWR+ WR +PDLDL+ Sbjct: 22 ISQLPEPLISEILCRLSTKDAVRTSLLSTSWRNLWRWVPDLDLN 65 >ref|XP_007045674.1| F-box/RNI-like superfamily protein [Theobroma cacao] gi|508709609|gb|EOY01506.1| F-box/RNI-like superfamily protein [Theobroma cacao] Length = 499 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/41 (58%), Positives = 36/41 (87%) Frame = -1 Query: 132 LSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDL 10 +S+LP+NVI+ IL RLP +DA RT++LSRSWR++W ++P+L Sbjct: 71 ISNLPDNVIESILGRLPIRDAVRTSILSRSWRYKWTALPNL 111 >ref|XP_009759006.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X3 [Nicotiana sylvestris] Length = 399 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 150 MGPLMSLSDLPENVIDEILSRLPTKDAGRTAVLSRSWRHRWRSIPDLDL 4 M PL LSDLP++VIDE+L RL +DA RT++LS+ WR+ W ++P L L Sbjct: 38 MPPLDVLSDLPKSVIDEVLMRLSLQDAVRTSILSKKWRYNWCTLPQLKL 86