BLASTX nr result
ID: Ophiopogon21_contig00034736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00034736 (423 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010917377.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_008797359.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_006659353.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_010917377.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Elaeis guineensis] Length = 900 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 422 SKVHQREILLKDPKCLHFFKDGKCSCRDYW 333 SKV+QREIL+KDPKCLH FK+GKCSCRD+W Sbjct: 871 SKVYQREILIKDPKCLHHFKEGKCSCRDFW 900 >ref|XP_008797359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Phoenix dactylifera] Length = 900 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 422 SKVHQREILLKDPKCLHFFKDGKCSCRDYW 333 SKV++REIL+KDPKCLH FKDGKCSCRD+W Sbjct: 871 SKVYRREILIKDPKCLHHFKDGKCSCRDFW 900 >ref|XP_006659353.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Oryza brachyantha] Length = 866 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 422 SKVHQREILLKDPKCLHFFKDGKCSCRDYW 333 SK ++R IL+KDPKCLH F+DGKCSC DYW Sbjct: 837 SKKYERHILIKDPKCLHKFEDGKCSCEDYW 866