BLASTX nr result
ID: Ophiopogon21_contig00034261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00034261 (583 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010091675.1| Chaperonin 60 subunit beta 4 [Morus notabili... 59 1e-06 >ref|XP_010091675.1| Chaperonin 60 subunit beta 4 [Morus notabilis] gi|587854916|gb|EXB44941.1| Chaperonin 60 subunit beta 4 [Morus notabilis] Length = 649 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = -2 Query: 531 KNSNQIKGEE--MLGIISFPWNWIQQLMDVMVAGLSLMLVLAIFAFIASILCSAAFLHNS 358 + +Q + EE M+ ++ F +Q ++D++VAG SLM+ L IFAFIAS+LCSAAFL N+ Sbjct: 589 RRRDQYRTEEKKMISVMGFS---VQSILDLVVAGFSLMIGLGIFAFIASVLCSAAFLQNA 645 Query: 357 KIAS 346 K AS Sbjct: 646 KDAS 649