BLASTX nr result
ID: Ophiopogon21_contig00032591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00032591 (458 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013658112.1| PREDICTED: uncharacterized protein LOC106362... 53 7e-06 >ref|XP_013658112.1| PREDICTED: uncharacterized protein LOC106362816 [Brassica napus] Length = 1707 Score = 52.8 bits (125), Expect(2) = 7e-06 Identities = 24/56 (42%), Positives = 37/56 (66%) Frame = +3 Query: 114 LSLVQWDKLCRAINLSGLGFRKTKPLHKAFMAKQLVRAAHSQTSIWARSILAKYRV 281 L LV WDK+C+ N GLG R++K ++KA +AK R +++ S+WA+ + KY V Sbjct: 1173 LHLVAWDKVCQQKNEGGLGIRRSKEMNKALIAKVGWRVMNNEQSLWAQVVRKKYSV 1228 Score = 23.5 bits (49), Expect(2) = 7e-06 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 2 SVLQVIPSYLLSSGWAPHGVLEKIEK 79 SVL IP + +S+ PH L+++++ Sbjct: 1132 SVLSSIPVHTMSTIMLPHSTLDQLDR 1157