BLASTX nr result
ID: Ophiopogon21_contig00032584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00032584 (363 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008790235.1| PREDICTED: putative pentatricopeptide repeat... 77 7e-12 ref|XP_010936130.1| PREDICTED: putative pentatricopeptide repeat... 71 4e-10 gb|KQL16145.1| hypothetical protein SETIT_024660mg, partial [Set... 69 2e-09 ref|XP_012699838.1| PREDICTED: putative pentatricopeptide repeat... 69 2e-09 gb|EMT06399.1| hypothetical protein F775_16833 [Aegilops tauschii] 69 2e-09 gb|EEC78894.1| hypothetical protein OsI_19266 [Oryza sativa Indi... 66 1e-08 ref|NP_001174317.1| Os05g0275100, partial [Oryza sativa Japonica... 66 1e-08 gb|AAT85126.1| hypothetical protein [Oryza sativa Japonica Group] 66 1e-08 ref|XP_006655158.1| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 ref|XP_009412297.1| PREDICTED: putative pentatricopeptide repeat... 61 4e-07 gb|KQK14377.1| hypothetical protein BRADI_1g15820 [Brachypodium ... 60 6e-07 ref|XP_010233256.1| PREDICTED: putative pentatricopeptide repeat... 60 6e-07 ref|XP_006856131.1| PREDICTED: putative pentatricopeptide repeat... 57 7e-06 >ref|XP_008790235.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Phoenix dactylifera] Length = 952 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/75 (46%), Positives = 49/75 (65%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFPEVGLREPLGSVENGIGKE 183 +E+GV PNYVTY TLVQGY+RC ++ +SKL E MHIRGLFP V + +G E K Sbjct: 878 VESGVDPNYVTYSTLVQGYIRCMDMHQISKLYEEMHIRGLFPAVAFKGNMGPAEPMAVKG 937 Query: 182 VEHTIGKMTAYVDCY 138 ++H ++ ++ Y Sbjct: 938 IKHGTINLSEHIHAY 952 >ref|XP_010936130.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Elaeis guineensis] gi|743836541|ref|XP_010936131.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Elaeis guineensis] Length = 955 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/75 (45%), Positives = 46/75 (61%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFPEVGLREPLGSVENGIGKE 183 +E+GV PNYVTY TLV Y+RC ++ +SKL E MHIRGLFP V + +G E K Sbjct: 881 VESGVDPNYVTYSTLVWRYIRCMDMHQISKLYEEMHIRGLFPAVAFKGNMGPAEPIAVKG 940 Query: 182 VEHTIGKMTAYVDCY 138 +H K+ ++ Y Sbjct: 941 TKHDTVKLFEHIHAY 955 >gb|KQL16145.1| hypothetical protein SETIT_024660mg, partial [Setaria italica] Length = 728 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFP 237 IEN V PNYVTY TL+QGY+RCGN++ +SKL + MHIRGL P Sbjct: 681 IENNVDPNYVTYWTLIQGYIRCGNMKEISKLYDEMHIRGLLP 722 >ref|XP_012699838.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] gi|835942125|ref|XP_012699839.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] gi|835942130|ref|XP_012699840.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] gi|835942133|ref|XP_012699841.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] gi|835942137|ref|XP_012699842.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] Length = 933 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFP 237 IEN V PNYVTY TL+QGY+RCGN++ +SKL + MHIRGL P Sbjct: 864 IENNVDPNYVTYWTLIQGYIRCGNMKEISKLYDEMHIRGLLP 905 >gb|EMT06399.1| hypothetical protein F775_16833 [Aegilops tauschii] Length = 1046 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFPEVG 228 IEN V PNYVTY TL+QGY+RCGN++ +SKL MHIRGL P G Sbjct: 867 IENNVDPNYVTYWTLIQGYVRCGNMKEISKLYNEMHIRGLLPANG 911 >gb|EEC78894.1| hypothetical protein OsI_19266 [Oryza sativa Indica Group] gi|222630938|gb|EEE63070.1| hypothetical protein OsJ_17878 [Oryza sativa Japonica Group] gi|937918192|dbj|BAS93110.1| Os05g0275100 [Oryza sativa Japonica Group] Length = 939 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFP 237 IEN V PNY+TYCTL+ GY++ GN++ +SKL + MHIRGL P Sbjct: 867 IENNVDPNYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 908 >ref|NP_001174317.1| Os05g0275100, partial [Oryza sativa Japonica Group] gi|255676205|dbj|BAH93045.1| Os05g0275100, partial [Oryza sativa Japonica Group] Length = 213 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFP 237 IEN V PNY+TYCTL+ GY++ GN++ +SKL + MHIRGL P Sbjct: 141 IENNVDPNYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 182 >gb|AAT85126.1| hypothetical protein [Oryza sativa Japonica Group] Length = 920 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFP 237 IEN V PNY+TYCTL+ GY++ GN++ +SKL + MHIRGL P Sbjct: 848 IENNVDPNYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 889 >ref|XP_006655158.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like [Oryza brachyantha] Length = 946 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFP 237 IEN + PNY+TYC L+ GY+R GN+ +SKL + MHIRGL P Sbjct: 874 IENNIDPNYITYCALLHGYIRSGNMNEISKLYDDMHIRGLVP 915 >ref|XP_009412297.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Musa acuminata subsp. malaccensis] gi|695048765|ref|XP_009412298.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Musa acuminata subsp. malaccensis] Length = 966 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFPEVGLRE 219 IE+GV P+YVTY TL+ GY++ G Q V+KL E MHIRGL P RE Sbjct: 893 IESGVDPDYVTYSTLIHGYIKRGETQQVTKLYEEMHIRGLLPVFAFRE 940 >gb|KQK14377.1| hypothetical protein BRADI_1g15820 [Brachypodium distachyon] Length = 635 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFP 237 IEN V PN++TY TL+QGY RCGN++ ++KL MHI GL P Sbjct: 564 IENNVDPNFITYWTLIQGYARCGNMKAITKLYNEMHICGLLP 605 >ref|XP_010233256.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Brachypodium distachyon] Length = 937 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -2 Query: 362 IENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFP 237 IEN V PN++TY TL+QGY RCGN++ ++KL MHI GL P Sbjct: 866 IENNVDPNFITYWTLIQGYARCGNMKAITKLYNEMHICGLLP 907 >ref|XP_006856131.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Amborella trichopoda] gi|548859990|gb|ERN17598.1| hypothetical protein AMTR_s00059p00156460 [Amborella trichopoda] Length = 962 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -2 Query: 359 ENGVGPNYVTYCTLVQGYMRCGNLQHVSKLNEAMHIRGLFPEV 231 E GV PN+VTY TLVQGY++ G++ +SKL + MHI+GL P V Sbjct: 900 EMGVDPNFVTYSTLVQGYIQSGDMGQISKLYDEMHIKGLLPGV 942