BLASTX nr result
ID: Ophiopogon21_contig00029895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00029895 (389 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010933063.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_010096162.1| Pentatricopeptide repeat-containing protein ... 76 1e-11 ref|XP_009387640.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 emb|CBI32449.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002281969.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_006423076.1| hypothetical protein CICLE_v10027854mg [Citr... 75 2e-11 ref|XP_003570175.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 gb|KDO49164.1| hypothetical protein CISIN_1g003913mg [Citrus sin... 74 3e-11 gb|KDO49163.1| hypothetical protein CISIN_1g003913mg [Citrus sin... 74 3e-11 ref|XP_006480143.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 gb|EPS74001.1| hypothetical protein M569_00754 [Genlisea aurea] 74 6e-11 ref|XP_008646124.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_009803628.1| PREDICTED: pentatricopeptide repeat-containi... 73 1e-10 ref|XP_008802954.1| PREDICTED: pentatricopeptide repeat-containi... 73 1e-10 gb|EMT05105.1| Pentatricopeptide repeat-containing protein [Aegi... 72 2e-10 gb|KCW45463.1| hypothetical protein EUGRSUZ_L00820 [Eucalyptus g... 72 2e-10 ref|XP_012836976.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 71 3e-10 ref|XP_010999833.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_010040589.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 71 4e-10 gb|KCW63832.1| hypothetical protein EUGRSUZ_G01504 [Eucalyptus g... 71 4e-10 >ref|XP_010933063.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Elaeis guineensis] Length = 816 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/65 (60%), Positives = 46/65 (70%), Gaps = 2/65 (3%) Frame = +2 Query: 197 EGNEDDAEELEGGSP--QFADVLAEDEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKE 370 EG+E +AE + G P Q A + D R L SP VEV+ELEE PEQWRR++IAWLCKE Sbjct: 94 EGDEGEAESEDAGRPLVQLLSDGAAERDMRSLPSPPVEVRELEEFPEQWRRAKIAWLCKE 153 Query: 371 LPSHK 385 LPSHK Sbjct: 154 LPSHK 158 >ref|XP_010096162.1| Pentatricopeptide repeat-containing protein [Morus notabilis] gi|587874419|gb|EXB63557.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 823 Score = 75.9 bits (185), Expect = 1e-11 Identities = 43/97 (44%), Positives = 58/97 (59%), Gaps = 7/97 (7%) Frame = +2 Query: 119 SLRPI---KLTVSPVNATSASVGPTRGQLEGNEDDAEELEGGSPQFADVLAE----DEDS 277 SLRPI + V+ +S V ++ +E + + GG P+ +E D Sbjct: 65 SLRPILTERRRFPAVSTSSTFVEQLESEVSPSEGEVGDF-GGFPESEPFDSEKCFASSDL 123 Query: 278 RRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHKP 388 + L +P +EVKELEELPEQWRRSR+AWLCKELP+HKP Sbjct: 124 KHLAAPKLEVKELEELPEQWRRSRLAWLCKELPAHKP 160 >ref|XP_009387640.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Musa acuminata subsp. malaccensis] Length = 788 Score = 75.9 bits (185), Expect = 1e-11 Identities = 46/96 (47%), Positives = 59/96 (61%), Gaps = 1/96 (1%) Frame = +2 Query: 101 PVRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEELEGGSPQ-FADVLAEDEDS 277 PVR + L P ++T A+ P + + +E++ E S + F DV AE E Sbjct: 36 PVRSLQTCSSPTLLGPPRSSTLATAQPLQQEEASDEEELTETVRPSVEPFHDVAAERE-M 94 Query: 278 RRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 R SP +EVKELEELPEQWRRS+IAWLCKELPS+K Sbjct: 95 RSFPSPELEVKELEELPEQWRRSKIAWLCKELPSYK 130 >emb|CBI32449.3| unnamed protein product [Vitis vinifera] Length = 790 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/76 (51%), Positives = 50/76 (65%), Gaps = 1/76 (1%) Frame = +2 Query: 164 SASVGPTRGQLEGNEDDAEELEGGSPQFA-DVLAEDEDSRRLTSPAVEVKELEELPEQWR 340 S+ V G+ E +E++ G F V D R L+SP++EVKELEELPEQWR Sbjct: 61 SSFVEQVVGESERDENEGFSRGGEGESFDFGVAFGSTDLRHLSSPSLEVKELEELPEQWR 120 Query: 341 RSRIAWLCKELPSHKP 388 RS++AWLCKELP+HKP Sbjct: 121 RSKLAWLCKELPAHKP 136 >ref|XP_002281969.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Vitis vinifera] Length = 823 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/76 (51%), Positives = 50/76 (65%), Gaps = 1/76 (1%) Frame = +2 Query: 164 SASVGPTRGQLEGNEDDAEELEGGSPQFA-DVLAEDEDSRRLTSPAVEVKELEELPEQWR 340 S+ V G+ E +E++ G F V D R L+SP++EVKELEELPEQWR Sbjct: 94 SSFVEQVVGESERDENEGFSRGGEGESFDFGVAFGSTDLRHLSSPSLEVKELEELPEQWR 153 Query: 341 RSRIAWLCKELPSHKP 388 RS++AWLCKELP+HKP Sbjct: 154 RSKLAWLCKELPAHKP 169 >ref|XP_006423076.1| hypothetical protein CICLE_v10027854mg [Citrus clementina] gi|557525010|gb|ESR36316.1| hypothetical protein CICLE_v10027854mg [Citrus clementina] Length = 787 Score = 75.1 bits (183), Expect = 2e-11 Identities = 43/100 (43%), Positives = 58/100 (58%), Gaps = 6/100 (6%) Frame = +2 Query: 104 VRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEEL------EGGSPQFADVLAE 265 VR P S + +S + S V G+ + ++++ ++ E GS F DV A Sbjct: 29 VRTPRSYHFLSAPLSSAASQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDF-DVGAA 87 Query: 266 DEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 + R L P VEV ELEELPEQWRR+++AWLCKELPSHK Sbjct: 88 GSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHK 127 >ref|XP_003570175.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Brachypodium distachyon] gi|944065313|gb|KQK00904.1| hypothetical protein BRADI_3g52580 [Brachypodium distachyon] Length = 787 Score = 75.1 bits (183), Expect = 2e-11 Identities = 43/99 (43%), Positives = 58/99 (58%), Gaps = 3/99 (3%) Frame = +2 Query: 98 SPVRFPFS-LRPIKLTVSPVNATSASVGPTRGQL--EGNEDDAEELEGGSPQFADVLAED 268 S VRF L P +L +SP ++ L E +++D EE + P + A Sbjct: 29 SVVRFEAPPLLPRRLAISPPRTRIPALASALESLVQESDDEDEEEEDDDGPFKGEAWAAA 88 Query: 269 EDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 ++ + SP +EV ELEELPEQWRRSRIAWLCKELP++K Sbjct: 89 DERDAVRSPELEVPELEELPEQWRRSRIAWLCKELPAYK 127 >gb|KDO49164.1| hypothetical protein CISIN_1g003913mg [Citrus sinensis] Length = 787 Score = 74.3 bits (181), Expect = 3e-11 Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 6/100 (6%) Frame = +2 Query: 104 VRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEEL------EGGSPQFADVLAE 265 VR P S + +S + S V G+ + ++++ ++ E GS F DV Sbjct: 29 VRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDF-DVGTA 87 Query: 266 DEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 + R L P VEV ELEELPEQWRR+++AWLCKELPSHK Sbjct: 88 GSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHK 127 >gb|KDO49163.1| hypothetical protein CISIN_1g003913mg [Citrus sinensis] Length = 761 Score = 74.3 bits (181), Expect = 3e-11 Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 6/100 (6%) Frame = +2 Query: 104 VRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEEL------EGGSPQFADVLAE 265 VR P S + +S + S V G+ + ++++ ++ E GS F DV Sbjct: 29 VRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDF-DVGTA 87 Query: 266 DEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 + R L P VEV ELEELPEQWRR+++AWLCKELPSHK Sbjct: 88 GSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHK 127 >ref|XP_006480143.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Citrus sinensis] Length = 787 Score = 74.3 bits (181), Expect = 3e-11 Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 6/100 (6%) Frame = +2 Query: 104 VRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEEL------EGGSPQFADVLAE 265 VR P S + +S + S V G+ + ++++ ++ E GS F DV Sbjct: 29 VRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDF-DVGTA 87 Query: 266 DEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 + R L P VEV ELEELPEQWRR+++AWLCKELPSHK Sbjct: 88 GSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHK 127 >gb|EPS74001.1| hypothetical protein M569_00754 [Genlisea aurea] Length = 850 Score = 73.6 bits (179), Expect = 6e-11 Identities = 46/99 (46%), Positives = 59/99 (59%), Gaps = 3/99 (3%) Frame = +2 Query: 98 SPVRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDA---EELEGGSPQFADVLAED 268 S VR P SL P TVS A P R + D+ ++ GS + + LA + Sbjct: 99 SNVRLPLSL-PFSATVS------ADDVPARVPKDAERDEIVNFSDITTGSLELDNSLALN 151 Query: 269 EDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 D +R SP VEVKELEELPEQWRR+++AWLCKELP+H+ Sbjct: 152 -DLKRRESPTVEVKELEELPEQWRRAKLAWLCKELPAHR 189 >ref|XP_008646124.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Zea mays] gi|413938429|gb|AFW72980.1| hypothetical protein ZEAMMB73_593295 [Zea mays] Length = 783 Score = 73.2 bits (178), Expect = 7e-11 Identities = 45/101 (44%), Positives = 57/101 (56%), Gaps = 6/101 (5%) Frame = +2 Query: 101 PVRFPFSLRPIKLTVSPVNATSASVGPTRGQ-----LEGNEDDAEELEG-GSPQFADVLA 262 P+ F S ++L P+ A +V P R L DD EE G G Q + A Sbjct: 23 PLPFATSHPAVRLAAPPLLARRLAVSPRRAASALEALVLESDDEEEESGIGLFQGEEWAA 82 Query: 263 EDEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 ++ + SP +EV ELEELPEQWRRSRIAWLCKELP++K Sbjct: 83 TADERDAVRSPELEVFELEELPEQWRRSRIAWLCKELPAYK 123 >ref|XP_009803628.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Nicotiana sylvestris] Length = 797 Score = 72.8 bits (177), Expect = 1e-10 Identities = 40/96 (41%), Positives = 59/96 (61%), Gaps = 5/96 (5%) Frame = +2 Query: 113 PFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEELEGGSPQFADVLAEDE-----DS 277 PFSL L+ SP++ V + +++GN + L+ S F + DE + Sbjct: 40 PFSLPLKPLSFSPLSTLPQQVLFSSHEIQGNNN----LDISSSVFPESFNFDESFDSTEL 95 Query: 278 RRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 ++ +PAVEV ELE++P+QWRRSR+AWLCKELP+HK Sbjct: 96 KKFETPAVEVSELEDIPDQWRRSRLAWLCKELPAHK 131 >ref|XP_008802954.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 isoform X1 [Phoenix dactylifera] Length = 717 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 266 DEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 + D R L SP VEV+ELEELPEQWRR+RIAWLCKELPSHK Sbjct: 20 ERDMRSLPSPTVEVRELEELPEQWRRARIAWLCKELPSHK 59 >gb|EMT05105.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii] Length = 785 Score = 72.0 bits (175), Expect = 2e-10 Identities = 40/89 (44%), Positives = 50/89 (56%), Gaps = 1/89 (1%) Frame = +2 Query: 122 LRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEELEGGSPQFADVLAEDEDSR-RLTSPA 298 L P +L +SP +V L DD ++ + S F D D R + SP Sbjct: 38 LPPRRLAISPPRVPIPAVASALESLVQESDDEDDEDDESGLFKDEAWASADERDAVRSPE 97 Query: 299 VEVKELEELPEQWRRSRIAWLCKELPSHK 385 + V ELEELPEQWRRSRIAWLCKELP++K Sbjct: 98 LVVPELEELPEQWRRSRIAWLCKELPAYK 126 >gb|KCW45463.1| hypothetical protein EUGRSUZ_L00820 [Eucalyptus grandis] Length = 574 Score = 71.6 bits (174), Expect = 2e-10 Identities = 49/102 (48%), Positives = 64/102 (62%), Gaps = 8/102 (7%) Frame = +2 Query: 104 VRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEELE-----GGSPQFA-DVLAE 265 +R PFS RP L VSP A+ AS+ + Q+ D E + G S F+ DV + Sbjct: 74 LRLPFS-RP-HLLVSP-RASPASLSSSVEQVVDGPDSDENWDFTSRGGDSDGFSFDVGSV 130 Query: 266 DEDSRRLTSP--AVEVKELEELPEQWRRSRIAWLCKELPSHK 385 D R+L SP AVEV+ELEE+PEQWRR+++AWLCKELP+ K Sbjct: 131 GSDMRQLASPPPAVEVRELEEVPEQWRRAKLAWLCKELPAQK 172 >ref|XP_012836976.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15820 [Erythranthe guttatus] Length = 781 Score = 71.2 bits (173), Expect = 3e-10 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 15/105 (14%) Frame = +2 Query: 116 FSLRPIKLTVSP--------VNATSASVGPTRGQL-----EGNEDDAEELEGGSPQFA-- 250 F LR + L P ++++S++ TR + E EDD + L + Sbjct: 25 FHLRRLSLRSKPHRNPILSLLSSSSSAAVSTRNVVCETLEEAKEDDFDVLRDNEAERYNF 84 Query: 251 DVLAEDEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHK 385 D E + +R SPAVEVKEL++LPEQWRRS++AWLCKELP+H+ Sbjct: 85 DGSFESTELKRFESPAVEVKELDDLPEQWRRSKLAWLCKELPAHR 129 >ref|XP_010999833.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Populus euphratica] Length = 819 Score = 70.9 bits (172), Expect = 4e-10 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 2/101 (1%) Frame = +2 Query: 92 FRSPVRFPFSLRPIKLT--VSPVNATSASVGPTRGQLEGNEDDAEELEGGSPQFADVLAE 265 F P+ P +L PI S AS + G L+ +E++ E + A Sbjct: 57 FPEPINTPQTLHPISTPKCFSTSVEQLASDSQSEGILDFDENERETFKFDDDGLGTSGAG 116 Query: 266 DEDSRRLTSPAVEVKELEELPEQWRRSRIAWLCKELPSHKP 388 D + L +P +EVKEL ELPEQWRR+++AWLCKELP+HKP Sbjct: 117 G-DGKHLDAPELEVKELAELPEQWRRAKLAWLCKELPAHKP 156 >ref|XP_010040589.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15820-like [Eucalyptus grandis] Length = 821 Score = 70.9 bits (172), Expect = 4e-10 Identities = 44/102 (43%), Positives = 62/102 (60%), Gaps = 8/102 (7%) Frame = +2 Query: 104 VRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEELE-----GGSPQFA-DVLAE 265 +R PFS P+ ++ A+ AS+ + Q+ D E + G S F+ DV + Sbjct: 73 LRLPFSRPPLLVSA---RASPASLSSSVEQVVDGPDSDENWDFTSRGGDSDGFSFDVGSV 129 Query: 266 DEDSRRLTSP--AVEVKELEELPEQWRRSRIAWLCKELPSHK 385 D R+L SP AVEV+ELEE+PEQWRR+++AWLCKELP+ K Sbjct: 130 GSDMRQLASPSPAVEVRELEEVPEQWRRAKLAWLCKELPAQK 171 >gb|KCW63832.1| hypothetical protein EUGRSUZ_G01504 [Eucalyptus grandis] Length = 708 Score = 70.9 bits (172), Expect = 4e-10 Identities = 49/103 (47%), Positives = 64/103 (62%), Gaps = 9/103 (8%) Frame = +2 Query: 104 VRFPFSLRPIKLTVSPVNATSASVGPTRGQLEGNEDDAEELE-----GGSPQFA-DVLAE 265 +R PFS RP L VSP A+ AS+ + Q+ D E + G S F+ DV + Sbjct: 76 LRLPFS-RP-HLLVSP-RASPASLSSSVEQVVDGPDSDENWDFTSRGGDSEGFSFDVGSL 132 Query: 266 DEDSRRLTSP---AVEVKELEELPEQWRRSRIAWLCKELPSHK 385 D R+L SP AVEVKEL+E+PEQWRR+++AWLCKELP+ K Sbjct: 133 GSDMRQLASPPPPAVEVKELQEVPEQWRRAKLAWLCKELPAQK 175