BLASTX nr result
ID: Ophiopogon21_contig00029846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00029846 (620 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010932063.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 52 9e-06 >ref|XP_010932063.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Elaeis guineensis] Length = 458 Score = 52.0 bits (123), Expect(2) = 9e-06 Identities = 29/72 (40%), Positives = 46/72 (63%) Frame = -2 Query: 415 ERATVLESLFMVAPPTPDSDKNMDIKITNSISDTMSNETIDLVSLHRHISMFTVTSPGAK 236 ERA VLE++ +VAPP D ++++ + NS S+ +S + +DL+ L +S+ TS A Sbjct: 376 ERAVVLETMVLVAPPKADLKESINHEQYNSASEAISQDNVDLMVLRGQLSLLPKTS-RAN 434 Query: 235 MVLWEYLEYDSS 200 +VL EYLE D + Sbjct: 435 IVLCEYLEDDKA 446 Score = 24.6 bits (52), Expect(2) = 9e-06 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 530 IKDVDDPTDVVFHHLK 483 I+ V +P+D+ F+HLK Sbjct: 339 IRSVPEPSDITFNHLK 354