BLASTX nr result
ID: Ophiopogon21_contig00029782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00029782 (588 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008659068.1| PREDICTED: uncharacterized protein At1g04910... 57 9e-06 >ref|XP_008659068.1| PREDICTED: uncharacterized protein At1g04910-like [Zea mays] Length = 587 Score = 56.6 bits (135), Expect = 9e-06 Identities = 32/67 (47%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = -2 Query: 323 SPAPYTP----RSRPASPGLLAKRRRTLNGDWRRRQSRSLAVWIGVVGFFVTVNWWMFSR 156 +P P P S PAS L RRR WRR R L VW +V FF +NWWMFSR Sbjct: 6 APPPLPPLLAVASSPASAALPRARRRQQRRGWRR--PRGLLVWGALVAFFFIMNWWMFSR 63 Query: 155 LQDSGHR 135 LQD R Sbjct: 64 LQDPSAR 70