BLASTX nr result
ID: Ophiopogon21_contig00029752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00029752 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010937348.1| PREDICTED: F-box protein At2g05970-like [Ela... 50 3e-08 >ref|XP_010937348.1| PREDICTED: F-box protein At2g05970-like [Elaeis guineensis] Length = 507 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 4/63 (6%) Frame = -1 Query: 303 EIH--VFRADLDEKAWVQVWSLGGRSLFI--DCHGGLASAAAASIEQRDRIYLAYXXLKR 136 EIH VFRADLDEKAWV+V SLGG +LFI C G + ++ A + DRIY + L+ Sbjct: 405 EIHLDVFRADLDEKAWVRVDSLGGGALFIGEGCSGWIPASRAGT--WGDRIYCSRSRLQL 462 Query: 135 TLK 127 T + Sbjct: 463 TTR 465 Score = 34.7 bits (78), Expect(2) = 3e-08 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 130 ETQWLWLEYNMKDGAVLYGKDPMALELGTNYRCCWFTP 17 E +W WLE+ + DG + P+ +E NY W P Sbjct: 470 EEEWCWLEHQVWDGKSCLHRPPVEIERRVNYSLFWIMP 507