BLASTX nr result
ID: Ophiopogon21_contig00029065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00029065 (1059 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB83794.1| hypothetical protein B456_013G265000 [Gossypium r... 60 2e-06 gb|KJB20168.1| hypothetical protein B456_003G136100 [Gossypium r... 59 5e-06 gb|KRH11364.1| hypothetical protein GLYMA_15G102600 [Glycine max] 59 7e-06 gb|KHN33076.1| 40S ribosomal protein S15a-1 [Glycine soja] 59 7e-06 emb|CBI31713.3| unnamed protein product [Vitis vinifera] 59 9e-06 >gb|KJB83794.1| hypothetical protein B456_013G265000 [Gossypium raimondii] Length = 240 Score = 60.5 bits (145), Expect = 2e-06 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 90 EKMVRVSVLNDALKSMYNAEKRGKRQVMIR 1 EKMVRVSVLNDALKSMYNAEKRGKRQVMIR Sbjct: 109 EKMVRVSVLNDALKSMYNAEKRGKRQVMIR 138 >gb|KJB20168.1| hypothetical protein B456_003G136100 [Gossypium raimondii] Length = 136 Score = 59.3 bits (142), Expect = 5e-06 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 90 EKMVRVSVLNDALKSMYNAEKRGKRQVMIR 1 E+MVRVSVLNDALKSMYNAEKRGKRQVMIR Sbjct: 5 ERMVRVSVLNDALKSMYNAEKRGKRQVMIR 34 >gb|KRH11364.1| hypothetical protein GLYMA_15G102600 [Glycine max] Length = 260 Score = 58.9 bits (141), Expect = 7e-06 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 105 LLLFAEKMVRVSVLNDALKSMYNAEKRGKRQVMIR 1 LL + MVRVSVLNDALKSMYNAEKRGKRQVMIR Sbjct: 44 LLCYLVTMVRVSVLNDALKSMYNAEKRGKRQVMIR 78 >gb|KHN33076.1| 40S ribosomal protein S15a-1 [Glycine soja] Length = 180 Score = 58.9 bits (141), Expect = 7e-06 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 105 LLLFAEKMVRVSVLNDALKSMYNAEKRGKRQVMIR 1 LL + MVRVSVLNDALKSMYNAEKRGKRQVMIR Sbjct: 44 LLCYLVTMVRVSVLNDALKSMYNAEKRGKRQVMIR 78 >emb|CBI31713.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 58.5 bits (140), Expect = 9e-06 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 87 KMVRVSVLNDALKSMYNAEKRGKRQVMIR 1 KMVRVSVLNDALKSMYNAEKRGKRQVMIR Sbjct: 45 KMVRVSVLNDALKSMYNAEKRGKRQVMIR 73