BLASTX nr result
ID: Ophiopogon21_contig00026625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00026625 (347 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus] 103 9e-40 >gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus] Length = 348 Score = 103 bits (258), Expect(2) = 9e-40 Identities = 50/62 (80%), Positives = 54/62 (87%) Frame = -2 Query: 346 NFPDEASVKSTNPKSSEKLDANPSFNYLTLSELDLYCDLDFIEEKVPVKPMEYLNAFNTV 167 NFPDEAS KST KSSE+ +ANPSFNYL + ELDLY D DFIEEKVPVKPM+YLNAFNTV Sbjct: 166 NFPDEASKKSTKLKSSEEHNANPSFNYLNVPELDLYSDFDFIEEKVPVKPMDYLNAFNTV 225 Query: 166 KP 161 KP Sbjct: 226 KP 227 Score = 86.7 bits (213), Expect(2) = 9e-40 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 155 NVNEANELKFLEVGSPVKKLKDNSGEGVCTGENSTAMELSEEISSFESYMK 3 NVN+ANE++FLEVG P+KKLK+NSGEGV GEN+TAMELSEE+S+FESYMK Sbjct: 250 NVNDANEIEFLEVGGPMKKLKNNSGEGVSAGENNTAMELSEELSAFESYMK 300