BLASTX nr result
ID: Ophiopogon21_contig00026301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00026301 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006450135.1| hypothetical protein CICLE_v10009502mg [Citr... 65 1e-08 ref|XP_009407490.1| PREDICTED: uncharacterized protein LOC103990... 65 2e-08 ref|XP_008802752.1| PREDICTED: uncharacterized protein LOC103716... 65 3e-08 ref|XP_006483595.1| PREDICTED: selenoprotein H-like [Citrus sine... 65 3e-08 ref|XP_013650195.1| PREDICTED: selenoprotein H-like [Brassica na... 64 3e-08 ref|XP_010922346.1| PREDICTED: selenoprotein H-like [Elaeis guin... 64 4e-08 ref|XP_010432872.1| PREDICTED: selenoprotein H-like [Camelina sa... 64 6e-08 ref|XP_012076318.1| PREDICTED: selenoprotein H [Jatropha curcas]... 64 6e-08 ref|XP_002869331.1| hypothetical protein ARALYDRAFT_913334 [Arab... 64 6e-08 ref|XP_010447579.1| PREDICTED: selenoprotein H-like [Camelina sa... 63 7e-08 ref|XP_009402262.1| PREDICTED: selenoprotein H-like [Musa acumin... 63 7e-08 ref|XP_013720331.1| PREDICTED: polyribonucleotide nucleotidyltra... 63 1e-07 ref|XP_013720330.1| PREDICTED: polyribonucleotide nucleotidyltra... 63 1e-07 emb|CDY23292.1| BnaA08g12540D [Brassica napus] 63 1e-07 gb|KFK29741.1| hypothetical protein AALP_AA7G172600 [Arabis alpina] 63 1e-07 ref|XP_012846527.1| PREDICTED: selenoprotein H-like [Erythranthe... 63 1e-07 ref|XP_013637734.1| PREDICTED: selenoprotein H [Brassica olerace... 62 1e-07 ref|XP_010438050.1| PREDICTED: selenoprotein H-like [Camelina sa... 62 1e-07 ref|XP_009127045.1| PREDICTED: selenoprotein H isoform X1 [Brass... 62 1e-07 ref|XP_013670783.1| PREDICTED: selenoprotein H-like [Brassica na... 62 1e-07 >ref|XP_006450135.1| hypothetical protein CICLE_v10009502mg [Citrus clementina] gi|557553361|gb|ESR63375.1| hypothetical protein CICLE_v10009502mg [Citrus clementina] Length = 207 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR+ GE FISLLDM RPF PMK+LDMDEVV DIV KLK Sbjct: 167 FEIRKDGGEKFISLLDMKRPFKPMKDLDMDEVVSDIVAKLK 207 >ref|XP_009407490.1| PREDICTED: uncharacterized protein LOC103990161 [Musa acuminata subsp. malaccensis] Length = 173 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKL 262 FEIR SG++F+SLL+M RPFTPMK LDMDEV++DIV+K+ Sbjct: 133 FEIREESGQIFVSLLNMPRPFTPMKKLDMDEVIQDIVKKI 172 >ref|XP_008802752.1| PREDICTED: uncharacterized protein LOC103716503 [Phoenix dactylifera] Length = 184 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKL 262 FEIR+ SGEVF+SLL+M RPFTPMK LDM++V+EDIV K+ Sbjct: 144 FEIRKESGEVFVSLLNMPRPFTPMKKLDMEKVIEDIVEKI 183 >ref|XP_006483595.1| PREDICTED: selenoprotein H-like [Citrus sinensis] gi|641848363|gb|KDO67240.1| hypothetical protein CISIN_1g028564mg [Citrus sinensis] Length = 207 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLLDM RPF PMK+LDMDEVV DIV KLK Sbjct: 167 FEIREDGGEKFISLLDMKRPFKPMKDLDMDEVVSDIVAKLK 207 >ref|XP_013650195.1| PREDICTED: selenoprotein H-like [Brassica napus] gi|674904866|emb|CDY28260.1| BnaA01g05890D [Brassica napus] Length = 179 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR+ GE FISLL+M RPF PMK LDM+EV+EDI++K+K Sbjct: 139 FEIRKEGGETFISLLEMKRPFAPMKALDMEEVIEDIIKKIK 179 >ref|XP_010922346.1| PREDICTED: selenoprotein H-like [Elaeis guineensis] Length = 184 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKL 262 FEIR+ SGEVF+SLL+M RPFTPMK LDM++V+EDI +K+ Sbjct: 144 FEIRKESGEVFVSLLNMPRPFTPMKKLDMEKVIEDIAKKI 183 >ref|XP_010432872.1| PREDICTED: selenoprotein H-like [Camelina sativa] Length = 189 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLL+M RPF PMK LDM+EV+EDI++K+K Sbjct: 149 FEIREEGGETFISLLEMKRPFAPMKALDMEEVIEDIIKKIK 189 >ref|XP_012076318.1| PREDICTED: selenoprotein H [Jatropha curcas] gi|643724233|gb|KDP33434.1| hypothetical protein JCGZ_07005 [Jatropha curcas] Length = 180 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIRR GE FISLLDM RPF PMK+LDM+EV+ DI+ K+K Sbjct: 140 FEIRREGGEKFISLLDMKRPFKPMKDLDMEEVIADIISKIK 180 >ref|XP_002869331.1| hypothetical protein ARALYDRAFT_913334 [Arabidopsis lyrata subsp. lyrata] gi|297315167|gb|EFH45590.1| hypothetical protein ARALYDRAFT_913334 [Arabidopsis lyrata subsp. lyrata] Length = 179 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLL+M RPF PMK LDM+EV+EDI++K+K Sbjct: 139 FEIREEGGETFISLLEMKRPFAPMKALDMEEVIEDIIKKIK 179 >ref|XP_010447579.1| PREDICTED: selenoprotein H-like [Camelina sativa] Length = 191 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR+ GE FISLL+M RPF PMK LDM++V+EDI++K+K Sbjct: 151 FEIRKEGGETFISLLEMKRPFAPMKALDMEQVIEDIIKKIK 191 >ref|XP_009402262.1| PREDICTED: selenoprotein H-like [Musa acuminata subsp. malaccensis] Length = 181 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKL 262 FEIR +G+VF+SLL+M RPFTPMK LDMD VVEDI++K+ Sbjct: 141 FEIREENGQVFVSLLNMPRPFTPMKKLDMDAVVEDIIKKI 180 >ref|XP_013720331.1| PREDICTED: polyribonucleotide nucleotidyltransferase-like [Brassica napus] Length = 112 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLL+M RPF PMK LDM+EV+EDI+ K+K Sbjct: 72 FEIREEGGETFISLLEMKRPFAPMKALDMEEVIEDIINKIK 112 >ref|XP_013720330.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like [Brassica napus] Length = 619 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLL+M RPF PMK LDM+EV+EDI+ K+K Sbjct: 579 FEIREEGGETFISLLEMKRPFAPMKALDMEEVIEDIINKIK 619 >emb|CDY23292.1| BnaA08g12540D [Brassica napus] Length = 631 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLL+M RPF PMK LDM+EV+EDI+ K+K Sbjct: 591 FEIREEGGETFISLLEMKRPFAPMKALDMEEVIEDIINKIK 631 >gb|KFK29741.1| hypothetical protein AALP_AA7G172600 [Arabis alpina] Length = 181 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLL+M RPF PMK LDM+EV+EDI++K+K Sbjct: 141 FEIREDGGETFISLLEMKRPFAPMKALDMEEVIEDIIKKVK 181 >ref|XP_012846527.1| PREDICTED: selenoprotein H-like [Erythranthe guttatus] gi|604318033|gb|EYU29733.1| hypothetical protein MIMGU_mgv1a019830mg [Erythranthe guttata] Length = 213 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GEVFISLLDM RPF P+K LDMDEV+ DI+ K++ Sbjct: 173 FEIREEGGEVFISLLDMKRPFPPLKKLDMDEVISDILEKIR 213 >ref|XP_013637734.1| PREDICTED: selenoprotein H [Brassica oleracea var. oleracea] Length = 145 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLL+M RPF PMK LDM+EV+EDI++K+K Sbjct: 105 FEIRVEGGETFISLLEMKRPFAPMKALDMEEVIEDIIKKIK 145 >ref|XP_010438050.1| PREDICTED: selenoprotein H-like [Camelina sativa] Length = 186 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR+ GE FISLL+M RPF PMK LDM+EV+E+I++K+K Sbjct: 146 FEIRKEGGETFISLLEMKRPFAPMKALDMEEVIENIIKKIK 186 >ref|XP_009127045.1| PREDICTED: selenoprotein H isoform X1 [Brassica rapa] Length = 176 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR G+ FISLL+M RPF PMK LDM+EV+EDI++K+K Sbjct: 136 FEIREEGGQTFISLLEMKRPFAPMKALDMEEVIEDIIKKIK 176 >ref|XP_013670783.1| PREDICTED: selenoprotein H-like [Brassica napus] gi|674964277|emb|CDX68739.1| BnaC01g07140D [Brassica napus] Length = 173 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 381 FEIRRASGEVFISLLDMNRPFTPMKNLDMDEVVEDIVRKLK 259 FEIR GE FISLL+M RPF PMK LDM+EV+EDI++K+K Sbjct: 133 FEIRVEGGETFISLLEMKRPFAPMKALDMEEVIEDIIKKIK 173