BLASTX nr result
ID: Ophiopogon21_contig00026250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00026250 (479 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014039485.1| PREDICTED: histidine-rich glycoprotein-like,... 60 5e-07 >ref|XP_014039485.1| PREDICTED: histidine-rich glycoprotein-like, partial [Salmo salar] Length = 429 Score = 60.5 bits (145), Expect = 5e-07 Identities = 39/118 (33%), Positives = 60/118 (50%), Gaps = 11/118 (9%) Frame = +3 Query: 3 HPHITVSRHTYHDIH----PTPLHAYTLNTIYHISPHTPYIYTARHHH-----HYIHVIR 155 H H T++ + H H P+P H +T+ T H I T +HHH H+ I Sbjct: 100 HHHRTITAPSPHHHHTITAPSPHHHHTITT--PSQHHHNTITTPQHHHTTPSQHHHSTIT 157 Query: 156 T*SPSYDTTSQTRHHQHHIQYPYHNNSKHTPA--HPTPSFPNARYIRTSSMTPQHIHS 323 SP + +T+ ++HH H I P+H+N+ TP H TPS ++ ++ TPQH H+ Sbjct: 158 APSPHHHSTTPSQHHHHTITAPHHHNTITTPQHHHTTPS----QHHHSTITTPQHHHT 211