BLASTX nr result
ID: Ophiopogon21_contig00024384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00024384 (1009 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008780476.1| PREDICTED: uncharacterized protein LOC103700... 52 5e-07 >ref|XP_008780476.1| PREDICTED: uncharacterized protein LOC103700307, partial [Phoenix dactylifera] Length = 278 Score = 51.6 bits (122), Expect(2) = 5e-07 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Frame = +1 Query: 37 ILIRSTSPEDRES-VRNGLWIVDDVTLAIEPWFPNFRPSPNRLSRTVLWL*LSDLPTVLW 213 + IR + EDRE+ +R+G W+V LA+E W PNF + R VLWL L LP W Sbjct: 125 VAIRFANAEDREAAMRSGPWMVAGQLLAMERWRPNFSTGAGGVGRVVLWLRLPSLPLDFW 184 Query: 214 TEYSLELIESHA 249 + ++ + + A Sbjct: 185 KKNTIFKVAARA 196 Score = 30.8 bits (68), Expect(2) = 5e-07 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +3 Query: 264 DDSTSSLAKARYARV-TEIDTSVPLVYSTNIEIKKAY-LSLFWQNFEYEH 407 D T + YARV E+D S PLV T + + A S FWQ F YE+ Sbjct: 203 DGFTEDRRRYGYARVKVELDASAPLVPGTWVLGRSADGASKFWQGFVYEN 252