BLASTX nr result
ID: Ophiopogon21_contig00024267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00024267 (371 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010941633.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-... 59 1e-06 >ref|XP_010941633.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Elaeis guineensis] Length = 169 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = -3 Query: 360 PCYPVLKFTAPANPAAGDKLQFGMYEIWNGRWKGGLAIREVVIEPS 223 P L FT PAN D L FG+YEIW GRWKGGL I+ V IE S Sbjct: 123 PAGTTLTFTVPANAKDQDNLTFGLYEIWRGRWKGGLVIKHVTIERS 168